Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5617
Gene name
LocationContig_282:206..2992
Strand-
Gene length (bp)2786
Transcript length (bp)2724
Coding sequence length (bp)2724
Protein length (aa) 908

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 5.8E-09 496 540
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 2.1E-10 499 559

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05950|REB1_KLULA DNA-binding protein REB1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REB1 PE=3 SV=2 466 710 2.0E-23
sp|Q12457|NSI1_YEAST RNA polymerase I termination factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSI1 PE=1 SV=1 466 617 2.0E-20
sp|Q9P6H9|REB1_SCHPO DNA-binding protein reb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=reb1 PE=3 SV=1 418 708 2.0E-15
sp|P21538|REB1_YEAST DNA-binding protein REB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REB1 PE=1 SV=2 466 580 4.0E-13
sp|Q9UUI6|RTF_SCHPO Replication termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rtf1 PE=1 SV=2 417 617 9.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05950|REB1_KLULA DNA-binding protein REB1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REB1 PE=3 SV=2 466 710 2.0E-23
sp|Q12457|NSI1_YEAST RNA polymerase I termination factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSI1 PE=1 SV=1 466 617 2.0E-20
sp|Q9P6H9|REB1_SCHPO DNA-binding protein reb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=reb1 PE=3 SV=1 418 708 2.0E-15
sp|P21538|REB1_YEAST DNA-binding protein REB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REB1 PE=1 SV=2 466 580 4.0E-13
sp|Q9UUI6|RTF_SCHPO Replication termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rtf1 PE=1 SV=2 417 617 9.0E-09
sp|Q54TN2|MYBC_DICDI Myb-like protein C OS=Dictyostelium discoideum GN=mybC PE=1 SV=1 436 619 8.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2509 0.9212 0.1667 0.0174 0.0241 0.0354 0.0259 0.0053 0.0683 0.0172

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3162
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6841
Ophiocordyceps australis map64 (Brazil) OphauB2|4527
Ophiocordyceps camponoti-floridani Ophcf2|03127
Ophiocordyceps camponoti-rufipedis Ophun1|3838
Ophiocordyceps kimflemingae Ophio5|3071
Ophiocordyceps subramaniannii Hirsu2|5617 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5617
MEDQESIGPEGLSDLQSEMDDGDFEIEMFDSINAPAPFSSAQPAPFSSSGQAPEAVMVEETPPLSPEKPDHDRDA
SSRAVESSLPPPDATDKKNKKKSKKSRKEKAAKTGIPDSQEHDDATTGDGELFVPSSTLTAGGPVQSADSLLELD
LDEGDKTTKSSKKKRKNSNAAESKRRKKRRSLGQDDPREQNYTDGASHLAAAAAFLRRSKDAVPPPEMAIEEEAA
DKSDPQKSPTITHLRRRSQPRSRSRENSIPPVDDADPMDVDPEPVPNVDPTVEQPGEADADAEVEALAREAWNEH
RNSQNAHVDTQDGDRTPAAAEPPRPSSQRPRSTRKKAKPTFYEQPPTEPISDEAYVPPELPSPSAMTPKPRNRSK
VAAKKTARGKRPKREEARDTPEDDDGEDRSQRMPRNRLVGFTQGRFSDEEIARIGTAIESFRVDHDLTQEQVNHM
IHAPGGTTAGDEHAQLWLRVFAECPNRHRQKVINIARKKFHNFIARGTWTLEQDAELTDLINVHGKKWSKIAAII
NRHPEDLRDRYRNYLVCGERQRKDAWDDTEEKNLTQYIIEAMEQIDELRTDKNPNRDIVTLSYEELIDWQNISER
MGRTRSRLQCITKWKSLNIRTHGKDKLVSTEPDASISFRLERARRQIAAMPEEEKFRMVLAIQGTAAGKDSKIPW
HRLVDKPFRHRWHRSTLMLLWQRLRQMVPGGENKTSRDCAHYLAEVYNETGELPEVEQGFDDVQEMAFMEKIPPA
FGGRLGPPPAQEQEKKSAEFVVDSDVEGADVTANGIGAEGVKEDDLQIDPALTQVDVPARKSVAAKRTGSGKPPS
RKKTKKAPTANMGPGPMEDEDDGPSEEQASGSDKEGEAGEDAVGPRQQTSTQSEQQPPSPHSEGSDSLMDDMDDL
PARLPAV*
Coding >Hirsu2|5617
ATGGAGGACCAGGAATCCATCGGACCCGAAGGCCTAAGCGACTTGCAGAGCGAAATGGACGACGGCGACTTCGAA
ATCGAAATGTTCGACAGCATCAACGCGCCCGCTCCCTTCTCGAGCGCGCAGCCGGCGCCCTTCTCGTCGAGCGGC
CAAGCACCCGAAGCCGTCATGGTCGAAGAAACACCGCCTCTCTCGCCCGAGAAGCCAGACCATGACCGAGACGCG
TCTTCACGCGCCGTTGAGTCGTCCTTGCCTCCGCCCGACGCCACCGACAAGAAGAACAAGAAGAAGAGCAAAAAA
TCCCGGAAGGAGAAGGCGGCCAAGACCGGGATCCCCGACAGTCAAGAACACGACGATGCCACCACCGGCGACGGC
GAACTATTCGTGCCGTCTTCGACCTTGACTGCCGGCGGCCCAGTCCAATCCGCGGACTCGCTGCTGGAGCTCGAC
CTTGACGAGGGTGACAAGACGACCAAGTCCTCCAAGAAGAAACGCAAAAACTCCAATGCTGCAGAGAGCAAGCGG
CGGAAGAAGAGACGGTCCCTGGGTCAAGACGACCCGCGTGAGCAAAATTATACCGATGGTGCCAGCCATCTGGCG
GCCGCCGCCGCCTTCTTGCGACGAAGCAAAGATGCCGTTCCGCCGCCCGAAATGGCCATCGAGGAGGAGGCCGCA
GACAAGTCGGACCCGCAAAAGTCGCCCACCATCACCCATCTACGGCGTCGCAGCCAGCCCCGGTCGAGGTCGAGG
GAGAATAGCATTCCCCCAGTAGACGACGCCGATCCGATGGACGTCGACCCCGAACCTGTCCCGAATGTGGACCCG
ACTGTCGAACAGCCTGGAGAGGCGGACGCCGATGCCGAAGTAGAGGCCCTGGCCAGGGAGGCCTGGAACGAGCAC
CGGAACAGCCAGAACGCGCATGTCGACACCCAGGACGGCGACAGGACCCCGGCGGCGGCCGAGCCTCCCCGCCCA
TCCTCACAGCGGCCGCGGTCGACCAGGAAGAAGGCCAAGCCGACGTTCTATGAGCAGCCCCCGACCGAGCCCATC
TCGGACGAGGCATACGTCCCGCCGGAATTGCCTTCGCCCTCAGCCATGACGCCGAAGCCTAGAAACCGGTCCAAG
GTTGCCGCGAAGAAGACGGCCAGGGGGAAGCGGCCCAAGAGGGAGGAAGCGCGCGACACGCCCGAGGACGACGAC
GGGGAGGACAGGTCCCAGCGAATGCCGCGAAACCGTCTCGTCGGCTTCACCCAGGGGCGATTCTCCGATGAGGAG
ATCGCCCGCATCGGCACGGCGATAGAGAGTTTCCGGGTCGATCATGACCTCACTCAGGAGCAAGTAAATCATATG
ATTCACGCACCGGGCGGTACCACTGCCGGCGACGAGCACGCCCAGCTCTGGCTTCGCGTCTTTGCCGAGTGCCCG
AACCGGCATCGACAGAAAGTCATCAACATCGCGCGCAAGAAATTCCACAACTTCATCGCCCGCGGAACCTGGACT
CTGGAGCAGGATGCCGAGCTGACGGACCTCATCAACGTCCACGGCAAGAAATGGTCCAAAATCGCCGCCATCATC
AACCGCCATCCGGAGGACCTCCGAGACCGGTATCGCAACTATCTCGTCTGCGGCGAGCGGCAGCGCAAGGATGCG
TGGGACGACACCGAGGAGAAGAACCTGACACAATACATCATCGAGGCCATGGAGCAGATTGACGAGCTGAGGACG
GACAAGAATCCGAACCGGGATATCGTCACCCTGTCATACGAGGAGCTCATCGACTGGCAGAACATAAGCGAGAGA
ATGGGCCGGACCAGGAGTCGGCTACAGTGCATCACCAAGTGGAAGTCGCTCAACATCCGCACGCACGGCAAGGAC
AAACTGGTCTCGACCGAGCCGGATGCCAGCATCTCGTTCCGGCTGGAGAGGGCCAGGCGGCAGATCGCGGCCATG
CCGGAGGAGGAGAAGTTCCGGATGGTGCTGGCCATACAGGGGACGGCGGCGGGCAAGGATTCCAAGATCCCGTGG
CATCGGCTGGTGGACAAGCCGTTTCGCCACCGCTGGCACCGCTCCACCCTGATGCTCCTGTGGCAGAGGCTGAGG
CAGATGGTCCCCGGCGGGGAGAACAAGACGTCGCGTGACTGCGCCCACTACCTGGCCGAGGTATACAACGAGACC
GGGGAGCTGCCCGAGGTGGAGCAGGGCTTCGACGACGTGCAGGAGATGGCGTTCATGGAGAAGATCCCGCCGGCG
TTTGGTGGGCGCCTCGGCCCGCCGCCGGCGCAGGAGCAGGAGAAGAAGAGCGCCGAATTCGTGGTGGACTCGGAC
GTGGAGGGGGCGGACGTGACGGCGAACGGCATCGGGGCCGAGGGCGTCAAGGAAGACGACCTCCAGATCGACCCA
GCGCTCACGCAGGTGGACGTGCCGGCCAGGAAGTCGGTCGCGGCGAAGAGGACGGGCTCGGGGAAGCCGCCGTCG
CGGAAGAAGACCAAAAAGGCACCGACGGCCAACATGGGCCCGGGCCCGATGGAGGATGAGGATGACGGCCCGAGC
GAAGAGCAGGCATCCGGAAGCGACAAGGAGGGCGAAGCGGGAGAGGATGCGGTGGGCCCTCGACAGCAGACGTCG
ACGCAATCAGAGCAGCAGCCACCTTCACCTCACAGCGAGGGATCGGACAGCCTCATGGACGACATGGACGACCTG
CCGGCTCGGCTGCCGGCCGTATAA
Transcript >Hirsu2|5617
ATGGAGGACCAGGAATCCATCGGACCCGAAGGCCTAAGCGACTTGCAGAGCGAAATGGACGACGGCGACTTCGAA
ATCGAAATGTTCGACAGCATCAACGCGCCCGCTCCCTTCTCGAGCGCGCAGCCGGCGCCCTTCTCGTCGAGCGGC
CAAGCACCCGAAGCCGTCATGGTCGAAGAAACACCGCCTCTCTCGCCCGAGAAGCCAGACCATGACCGAGACGCG
TCTTCACGCGCCGTTGAGTCGTCCTTGCCTCCGCCCGACGCCACCGACAAGAAGAACAAGAAGAAGAGCAAAAAA
TCCCGGAAGGAGAAGGCGGCCAAGACCGGGATCCCCGACAGTCAAGAACACGACGATGCCACCACCGGCGACGGC
GAACTATTCGTGCCGTCTTCGACCTTGACTGCCGGCGGCCCAGTCCAATCCGCGGACTCGCTGCTGGAGCTCGAC
CTTGACGAGGGTGACAAGACGACCAAGTCCTCCAAGAAGAAACGCAAAAACTCCAATGCTGCAGAGAGCAAGCGG
CGGAAGAAGAGACGGTCCCTGGGTCAAGACGACCCGCGTGAGCAAAATTATACCGATGGTGCCAGCCATCTGGCG
GCCGCCGCCGCCTTCTTGCGACGAAGCAAAGATGCCGTTCCGCCGCCCGAAATGGCCATCGAGGAGGAGGCCGCA
GACAAGTCGGACCCGCAAAAGTCGCCCACCATCACCCATCTACGGCGTCGCAGCCAGCCCCGGTCGAGGTCGAGG
GAGAATAGCATTCCCCCAGTAGACGACGCCGATCCGATGGACGTCGACCCCGAACCTGTCCCGAATGTGGACCCG
ACTGTCGAACAGCCTGGAGAGGCGGACGCCGATGCCGAAGTAGAGGCCCTGGCCAGGGAGGCCTGGAACGAGCAC
CGGAACAGCCAGAACGCGCATGTCGACACCCAGGACGGCGACAGGACCCCGGCGGCGGCCGAGCCTCCCCGCCCA
TCCTCACAGCGGCCGCGGTCGACCAGGAAGAAGGCCAAGCCGACGTTCTATGAGCAGCCCCCGACCGAGCCCATC
TCGGACGAGGCATACGTCCCGCCGGAATTGCCTTCGCCCTCAGCCATGACGCCGAAGCCTAGAAACCGGTCCAAG
GTTGCCGCGAAGAAGACGGCCAGGGGGAAGCGGCCCAAGAGGGAGGAAGCGCGCGACACGCCCGAGGACGACGAC
GGGGAGGACAGGTCCCAGCGAATGCCGCGAAACCGTCTCGTCGGCTTCACCCAGGGGCGATTCTCCGATGAGGAG
ATCGCCCGCATCGGCACGGCGATAGAGAGTTTCCGGGTCGATCATGACCTCACTCAGGAGCAAGTAAATCATATG
ATTCACGCACCGGGCGGTACCACTGCCGGCGACGAGCACGCCCAGCTCTGGCTTCGCGTCTTTGCCGAGTGCCCG
AACCGGCATCGACAGAAAGTCATCAACATCGCGCGCAAGAAATTCCACAACTTCATCGCCCGCGGAACCTGGACT
CTGGAGCAGGATGCCGAGCTGACGGACCTCATCAACGTCCACGGCAAGAAATGGTCCAAAATCGCCGCCATCATC
AACCGCCATCCGGAGGACCTCCGAGACCGGTATCGCAACTATCTCGTCTGCGGCGAGCGGCAGCGCAAGGATGCG
TGGGACGACACCGAGGAGAAGAACCTGACACAATACATCATCGAGGCCATGGAGCAGATTGACGAGCTGAGGACG
GACAAGAATCCGAACCGGGATATCGTCACCCTGTCATACGAGGAGCTCATCGACTGGCAGAACATAAGCGAGAGA
ATGGGCCGGACCAGGAGTCGGCTACAGTGCATCACCAAGTGGAAGTCGCTCAACATCCGCACGCACGGCAAGGAC
AAACTGGTCTCGACCGAGCCGGATGCCAGCATCTCGTTCCGGCTGGAGAGGGCCAGGCGGCAGATCGCGGCCATG
CCGGAGGAGGAGAAGTTCCGGATGGTGCTGGCCATACAGGGGACGGCGGCGGGCAAGGATTCCAAGATCCCGTGG
CATCGGCTGGTGGACAAGCCGTTTCGCCACCGCTGGCACCGCTCCACCCTGATGCTCCTGTGGCAGAGGCTGAGG
CAGATGGTCCCCGGCGGGGAGAACAAGACGTCGCGTGACTGCGCCCACTACCTGGCCGAGGTATACAACGAGACC
GGGGAGCTGCCCGAGGTGGAGCAGGGCTTCGACGACGTGCAGGAGATGGCGTTCATGGAGAAGATCCCGCCGGCG
TTTGGTGGGCGCCTCGGCCCGCCGCCGGCGCAGGAGCAGGAGAAGAAGAGCGCCGAATTCGTGGTGGACTCGGAC
GTGGAGGGGGCGGACGTGACGGCGAACGGCATCGGGGCCGAGGGCGTCAAGGAAGACGACCTCCAGATCGACCCA
GCGCTCACGCAGGTGGACGTGCCGGCCAGGAAGTCGGTCGCGGCGAAGAGGACGGGCTCGGGGAAGCCGCCGTCG
CGGAAGAAGACCAAAAAGGCACCGACGGCCAACATGGGCCCGGGCCCGATGGAGGATGAGGATGACGGCCCGAGC
GAAGAGCAGGCATCCGGAAGCGACAAGGAGGGCGAAGCGGGAGAGGATGCGGTGGGCCCTCGACAGCAGACGTCG
ACGCAATCAGAGCAGCAGCCACCTTCACCTCACAGCGAGGGATCGGACAGCCTCATGGACGACATGGACGACCTG
CCGGCTCGGCTGCCGGCCGTATAA
Gene >Hirsu2|5617
ATGGAGGACCAGGAATCCATCGGACCCGAAGGCCTAAGCGACTTGCAGAGCGAAATGGACGACGGCGACTTCGAA
ATCGAAATGTTCGACAGCATCAACGCGCCCGCTCCCTTCTCGAGCGCGCAGCCGGCGCCCTTCTCGTCGAGCGGC
CAAGCACCCGAAGCCGTCATGGTCGAAGAAACACCGCCTCTCTCGCCCGAGAAGCCAGACCATGACCGAGACGCG
TCTTCACGCGCCGTTGAGTCGTCCTTGCCTCCGCCCGACGCCACCGACAAGAAGAACAAGAAGAAGAGCAAAAAA
TCCCGGAAGGAGAAGGCGGCCAAGACCGGGATCCCCGACAGTCAAGAACACGACGATGCCACCACCGGCGACGGC
GAACTATTCGTGCCGTCTTCGACCTTGACTGCCGGCGGCCCAGTCCAATCCGCGGACTCGCTGCTGGAGCTCGAC
CTTGACGAGGGTGACAAGACGACCAAGTCCTCCAAGAAGAAACGCAAAAACTCCAATGCTGCAGAGAGCAAGCGG
CGGAAGAAGAGACGGTCCCTGGGTCAAGACGACCCGCGTGAGCAAAATTATACCGATGGTGCCAGCCATCTGGCG
GCCGCCGCCGCCTTCTTGCGACGAAGCAAAGATGCCGTTCCGCCGCCCGAAATGGCCATCGAGGAGGAGGCCGCA
GACAAGTCGGACCCGCAAAAGTCGCCCACCATCACCCATCTACGGCGTCGCAGCCAGCCCCGGTCGAGGTCGAGG
GAGAATAGCATTCCCCCAGTAGACGACGCCGATCCGATGGACGTCGACCCCGAACCTGTCCCGAATGTGGACCCG
ACTGTCGAACAGCCTGGAGAGGCGGACGCCGATGCCGAAGTAGAGGCCCTGGCCAGGGAGGCCTGGAACGAGCAC
CGGAACAGCCAGAACGCGCATGTCGACACCCAGGACGGCGACAGGACCCCGGCGGCGGCCGAGCCTCCCCGCCCA
TCCTCACAGCGGCCGCGGTCGACCAGGAAGAAGGCCAAGCCGACGTTCTATGAGCAGCCCCCGACCGAGCCCATC
TCGGACGAGGCATACGTCCCGCCGGAATTGCCTTCGCCCTCAGCCATGACGCCGAAGCCTAGAAACCGGTCCAAG
GTTGCCGCGAAGAAGACGGCCAGGGGGAAGCGGCCCAAGAGGGAGGAAGCGCGCGACACGCCCGAGGACGACGAC
GGGGAGGACAGGTCCCAGCGAATGCCGCGAAACCGTCTCGTCGGCTTCACCCAGGGGCGATTCTCCGATGAGGAG
ATCGCCCGCATCGGCACGGCGATAGAGAGTTTCCGGGTCGATCATGACCTCACTCAGGAGCAAGTAAATCATGTG
AGCCAGACTGCCTTTTCCTCGCCGCGGCTGACGCAAAGACTGACGAGAAGAAAATGTAGATGATTCACGCACCGG
GCGGTACCACTGCCGGCGACGAGCACGCCCAGCTCTGGCTTCGCGTCTTTGCCGAGTGCCCGAACCGGCATCGAC
AGAAAGTCATCAACATCGCGCGCAAGAAATTCCACAACTTCATCGCCCGCGGAACCTGGACTCTGGAGCAGGATG
CCGAGCTGACGGACCTCATCAACGTCCACGGCAAGAAATGGTCCAAAATCGCCGCCATCATCAACCGCCATCCGG
AGGACCTCCGAGACCGGTATCGCAACTATCTCGTCTGCGGCGAGCGGCAGCGCAAGGATGCGTGGGACGACACCG
AGGAGAAGAACCTGACACAATACATCATCGAGGCCATGGAGCAGATTGACGAGCTGAGGACGGACAAGAATCCGA
ACCGGGATATCGTCACCCTGTCATACGAGGAGCTCATCGACTGGCAGAACATAAGCGAGAGAATGGGCCGGACCA
GGAGTCGGCTACAGTGCATCACCAAGTGGAAGTCGCTCAACATCCGCACGCACGGCAAGGACAAACTGGTCTCGA
CCGAGCCGGATGCCAGCATCTCGTTCCGGCTGGAGAGGGCCAGGCGGCAGATCGCGGCCATGCCGGAGGAGGAGA
AGTTCCGGATGGTGCTGGCCATACAGGGGACGGCGGCGGGCAAGGATTCCAAGATCCCGTGGCATCGGCTGGTGG
ACAAGCCGTTTCGCCACCGCTGGCACCGCTCCACCCTGATGCTCCTGTGGCAGAGGCTGAGGCAGATGGTCCCCG
GCGGGGAGAACAAGACGTCGCGTGACTGCGCCCACTACCTGGCCGAGGTATACAACGAGACCGGGGAGCTGCCCG
AGGTGGAGCAGGGCTTCGACGACGTGCAGGAGATGGCGTTCATGGAGAAGATCCCGCCGGCGTTTGGTGGGCGCC
TCGGCCCGCCGCCGGCGCAGGAGCAGGAGAAGAAGAGCGCCGAATTCGTGGTGGACTCGGACGTGGAGGGGGCGG
ACGTGACGGCGAACGGCATCGGGGCCGAGGGCGTCAAGGAAGACGACCTCCAGATCGACCCAGCGCTCACGCAGG
TGGACGTGCCGGCCAGGAAGTCGGTCGCGGCGAAGAGGACGGGCTCGGGGAAGCCGCCGTCGCGGAAGAAGACCA
AAAAGGCACCGACGGCCAACATGGGCCCGGGCCCGATGGAGGATGAGGATGACGGCCCGAGCGAAGAGCAGGCAT
CCGGAAGCGACAAGGAGGGCGAAGCGGGAGAGGATGCGGTGGGCCCTCGACAGCAGACGTCGACGCAATCAGAGC
AGCAGCCACCTTCACCTCACAGCGAGGGATCGGACAGCCTCATGGACGACATGGACGACCTGCCGGCTCGGCTGC
CGGCCGTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail