Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5614
Gene name
LocationContig_2816:275..1028
Strand-
Gene length (bp)753
Transcript length (bp)696
Coding sequence length (bp)696
Protein length (aa) 232

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01202 SKI Shikimate kinase 1.0E-10 61 175
PF13671 AAA_33 AAA domain 7.5E-08 54 176
PF13238 AAA_18 AAA domain 4.7E-07 55 174

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10242|GNTK_SCHPO Probable gluconokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.12 PE=3 SV=1 41 217 7.0E-41
sp|P39208|IDNK_ECOLI Thermosensitive gluconokinase OS=Escherichia coli (strain K12) GN=idnK PE=3 SV=1 54 212 5.0E-34
sp|Q54PI5|GNTK_DICDI Probable gluconokinase OS=Dictyostelium discoideum GN=DDB_G0284557 PE=3 SV=1 53 212 2.0E-32
sp|Q03786|GNTK_YEAST Probable gluconokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR248C PE=1 SV=1 53 221 3.0E-30
sp|P46859|GNTK_ECOLI Thermoresistant gluconokinase OS=Escherichia coli (strain K12) GN=gntK PE=1 SV=4 51 212 1.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10242|GNTK_SCHPO Probable gluconokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G9.12 PE=3 SV=1 41 217 7.0E-41
sp|P39208|IDNK_ECOLI Thermosensitive gluconokinase OS=Escherichia coli (strain K12) GN=idnK PE=3 SV=1 54 212 5.0E-34
sp|Q54PI5|GNTK_DICDI Probable gluconokinase OS=Dictyostelium discoideum GN=DDB_G0284557 PE=3 SV=1 53 212 2.0E-32
sp|Q03786|GNTK_YEAST Probable gluconokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR248C PE=1 SV=1 53 221 3.0E-30
sp|P46859|GNTK_ECOLI Thermoresistant gluconokinase OS=Escherichia coli (strain K12) GN=gntK PE=1 SV=4 51 212 1.0E-28
sp|Q5T6J7|GNTK_HUMAN Probable gluconokinase OS=Homo sapiens GN=IDNK PE=1 SV=1 55 212 4.0E-28
sp|Q8R0J8|GNTK_MOUSE Probable gluconokinase OS=Mus musculus GN=Idnk PE=1 SV=2 53 212 1.0E-27
sp|Q5FQ97|GCNK_GLUOX Gluconokinase OS=Gluconobacter oxydans (strain 621H) GN=GOX1709 PE=1 SV=1 55 217 3.0E-27
sp|Q32PY9|GNTK_RAT Probable gluconokinase OS=Rattus norvegicus GN=Idnk PE=2 SV=1 53 212 1.0E-26
sp|B0BML1|GNTK_XENTR Probable gluconokinase OS=Xenopus tropicalis GN=idnk PE=2 SV=1 53 209 6.0E-26
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5614
MLSFDNMMPVNGQESGAPARQLQASSSPRTSSSAAANEAATRANGQARKHHHIWLVTGPAGCGKTTVGEYLAGAL
GVPYVEGDSYHTPANVDKMRSGIPLTDADRWDWLTALRDESMRRIDGGSGGVVVTCSALKRKYRDVIRVAAYYDH
DILVHFIFLNAPADVLLQRVSDRQGHYMGPGMVQSQFDILERPAEMERDVISIDVSRSIDEVKKDALARVSDITK
AAARRG*
Coding >Hirsu2|5614
ATGCTGTCTTTCGATAACATGATGCCGGTCAATGGACAGGAGTCGGGAGCGCCGGCCAGGCAACTTCAGGCCTCA
TCGTCGCCCAGGACGTCATCGTCGGCCGCGGCCAATGAGGCGGCAACTCGTGCGAACGGCCAGGCACGGAAGCAT
CATCACATTTGGCTGGTCACGGGCCCGGCCGGGTGCGGCAAGACGACGGTGGGCGAGTACCTGGCGGGCGCGCTC
GGCGTGCCGTACGTCGAAGGCGATTCGTACCACACGCCGGCCAACGTGGACAAGATGCGCAGCGGCATCCCGCTC
ACCGACGCAGACCGCTGGGACTGGCTGACGGCCCTGCGCGACGAATCGATGCGACGGATCGACGGCGGCTCCGGC
GGCGTCGTCGTCACCTGCTCGGCCCTCAAGCGCAAGTACCGCGACGTGATCCGCGTCGCCGCCTACTACGACCAC
GACATCCTCGTCCACTTCATCTTCCTCAACGCCCCCGCCGACGTGCTCCTGCAGAGGGTCAGCGACCGCCAGGGC
CACTACATGGGGCCCGGCATGGTCCAGAGCCAGTTCGACATTCTCGAGCGGCCGGCCGAGATGGAGAGGGACGTG
ATTAGCATCGACGTCAGCCGCAGCATCGACGAGGTCAAGAAGGATGCTCTAGCCAGGGTCTCGGATATTACAAAG
GCCGCTGCCCGACGAGGCTAA
Transcript >Hirsu2|5614
ATGCTGTCTTTCGATAACATGATGCCGGTCAATGGACAGGAGTCGGGAGCGCCGGCCAGGCAACTTCAGGCCTCA
TCGTCGCCCAGGACGTCATCGTCGGCCGCGGCCAATGAGGCGGCAACTCGTGCGAACGGCCAGGCACGGAAGCAT
CATCACATTTGGCTGGTCACGGGCCCGGCCGGGTGCGGCAAGACGACGGTGGGCGAGTACCTGGCGGGCGCGCTC
GGCGTGCCGTACGTCGAAGGCGATTCGTACCACACGCCGGCCAACGTGGACAAGATGCGCAGCGGCATCCCGCTC
ACCGACGCAGACCGCTGGGACTGGCTGACGGCCCTGCGCGACGAATCGATGCGACGGATCGACGGCGGCTCCGGC
GGCGTCGTCGTCACCTGCTCGGCCCTCAAGCGCAAGTACCGCGACGTGATCCGCGTCGCCGCCTACTACGACCAC
GACATCCTCGTCCACTTCATCTTCCTCAACGCCCCCGCCGACGTGCTCCTGCAGAGGGTCAGCGACCGCCAGGGC
CACTACATGGGGCCCGGCATGGTCCAGAGCCAGTTCGACATTCTCGAGCGGCCGGCCGAGATGGAGAGGGACGTG
ATTAGCATCGACGTCAGCCGCAGCATCGACGAGGTCAAGAAGGATGCTCTAGCCAGGGTCTCGGATATTACAAAG
GCCGCTGCCCGACGAGGCTAA
Gene >Hirsu2|5614
ATGCTGTCTTTCGATAACATGATGCCGGTCAATGGACAGGAGTCGGGAGCGCCGGCCAGGCAACTTCAGGCCTCA
TCGTCGCCCAGGACGTCATCGTCGGCCGCGGCCAATGAGGCGGCAACTCGTGCGAACGGCCAGGCACGGAAGCAT
CATCACATTTGGCTGGTCACGGGCCCGGCCGGGTGCGGCAAGACGACGGTGGGCGAGTACCTGGCGGGCGCGCTC
GGCGTGCCGTACGTCGAAGGCGATTCGGTAGGAAGCACAGGCTCGGCTTGATTCGCCCCCCCCCGACCGCTAACG
ACGGCTCAGTACCACACGCCGGCCAACGTGGACAAGATGCGCAGCGGCATCCCGCTCACCGACGCAGACCGCTGG
GACTGGCTGACGGCCCTGCGCGACGAATCGATGCGACGGATCGACGGCGGCTCCGGCGGCGTCGTCGTCACCTGC
TCGGCCCTCAAGCGCAAGTACCGCGACGTGATCCGCGTCGCCGCCTACTACGACCACGACATCCTCGTCCACTTC
ATCTTCCTCAACGCCCCCGCCGACGTGCTCCTGCAGAGGGTCAGCGACCGCCAGGGCCACTACATGGGGCCCGGC
ATGGTCCAGAGCCAGTTCGACATTCTCGAGCGGCCGGCCGAGATGGAGAGGGACGTGATTAGCATCGACGTCAGC
CGCAGCATCGACGAGGTCAAGAAGGATGCTCTAGCCAGGGTCTCGGATATTACAAAGGCCGCTGCCCGACGAGGC
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail