Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5596
Gene name
LocationContig_2801:745..1716
Strand+
Gene length (bp)971
Transcript length (bp)747
Coding sequence length (bp)747
Protein length (aa) 249

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5112 0.8093 0.2525 0.0698 0.1052 0.0211 0.0384 0.0685 0.0402 0.0266

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6183
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|833
Ophiocordyceps australis map64 (Brazil) OphauB2|4959
Ophiocordyceps camponoti-rufipedis Ophun1|978
Ophiocordyceps kimflemingae Ophio5|8247
Ophiocordyceps subramaniannii Hirsu2|5596 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5596
MASSRNKTTRVDDELHAPDVAMAGWKRAGPPQIPANQRRFKGWGNDTGLPVGEAGLHAEEETCRPSYRNGQSEVQ
DELSVIGMGTELGTGSIEKGMEAVVTRKRLGELTRKYNDLKARHKDLWQMGIKSAERNFNDLKGQTEQNMAASNK
LVAQLKSELTAQSTLVDQTAHRLECSQTSGEGLQAEINKLIKSLSDARAEVAMLSAKLGASKNFEASATDADSVA
KANATVSEATTQLAAFKLVEMGR*
Coding >Hirsu2|5596
ATGGCTTCGTCAAGGAACAAGACAACTCGCGTTGATGATGAGTTACATGCGCCTGATGTGGCGATGGCTGGTTGG
AAACGAGCTGGGCCACCCCAGATCCCTGCAAATCAGAGAAGATTCAAAGGTTGGGGAAACGATACTGGCTTACCT
GTTGGCGAGGCAGGTCTCCATGCAGAAGAAGAAACCTGTCGTCCGTCTTATAGAAATGGCCAGTCTGAAGTCCAA
GACGAGTTGTCTGTGATTGGCATGGGAACAGAATTGGGGACCGGCAGCATTGAAAAGGGGATGGAGGCTGTCGTT
ACGCGAAAACGATTGGGGGAACTAACAAGAAAATACAACGACTTGAAAGCACGTCATAAAGACCTCTGGCAAATG
GGGATCAAGTCCGCAGAGCGCAACTTCAATGACTTAAAGGGGCAGACCGAGCAGAACATGGCGGCTTCCAACAAA
CTCGTTGCGCAGCTGAAATCAGAACTCACAGCGCAATCCACATTGGTGGATCAAACCGCACATCGGCTAGAGTGC
AGCCAAACGAGTGGTGAAGGCCTACAGGCTGAAATTAATAAGCTGATCAAGTCACTCTCGGATGCAAGAGCAGAA
GTTGCCATGCTATCGGCCAAACTTGGTGCCAGCAAAAACTTCGAAGCCTCAGCGACGGACGCAGATAGTGTCGCG
AAAGCCAACGCCACAGTTTCAGAGGCCACAACACAATTGGCTGCATTCAAACTGGTCGAAATGGGACGTTAA
Transcript >Hirsu2|5596
ATGGCTTCGTCAAGGAACAAGACAACTCGCGTTGATGATGAGTTACATGCGCCTGATGTGGCGATGGCTGGTTGG
AAACGAGCTGGGCCACCCCAGATCCCTGCAAATCAGAGAAGATTCAAAGGTTGGGGAAACGATACTGGCTTACCT
GTTGGCGAGGCAGGTCTCCATGCAGAAGAAGAAACCTGTCGTCCGTCTTATAGAAATGGCCAGTCTGAAGTCCAA
GACGAGTTGTCTGTGATTGGCATGGGAACAGAATTGGGGACCGGCAGCATTGAAAAGGGGATGGAGGCTGTCGTT
ACGCGAAAACGATTGGGGGAACTAACAAGAAAATACAACGACTTGAAAGCACGTCATAAAGACCTCTGGCAAATG
GGGATCAAGTCCGCAGAGCGCAACTTCAATGACTTAAAGGGGCAGACCGAGCAGAACATGGCGGCTTCCAACAAA
CTCGTTGCGCAGCTGAAATCAGAACTCACAGCGCAATCCACATTGGTGGATCAAACCGCACATCGGCTAGAGTGC
AGCCAAACGAGTGGTGAAGGCCTACAGGCTGAAATTAATAAGCTGATCAAGTCACTCTCGGATGCAAGAGCAGAA
GTTGCCATGCTATCGGCCAAACTTGGTGCCAGCAAAAACTTCGAAGCCTCAGCGACGGACGCAGATAGTGTCGCG
AAAGCCAACGCCACAGTTTCAGAGGCCACAACACAATTGGCTGCATTCAAACTGGTCGAAATGGGACGTTAA
Gene >Hirsu2|5596
ATGGCTTCGTCAAGGAACAAGACAACTCGCGTTGATGATGAGTTACATGCGCCTGATGTGGCGATGGCTGGTTGG
AAACGAGCTGGGCCACCCCAGATCCCTGCAAATCAGAGAAGATTCAAAGGTTGGGGAAACGATACTGGCTTACCT
GTTGGCGAGGCAGGTCTCCATGCAGAAGAAGAAACCTGTCGTCCGTCTTATAGAAATGGCCAGTCTGAAGTCCAA
GACGAGTTGTCTGTGATTGGCATGGGAACAGAATTGGGGACCGGCAGCATTGAAAAGGGGATGGAGGCTGTCGTT
ACGCGAAAACGATTGGGGGAACTAACAAGAAAATACAACGACTTGAAAGCACGTCATAAAGACCTCTGGCAAATG
GGGATCAAGTCCGCAGAGCGCAACTTCAATGACTTAAAGGGGCAGACCGAGCAGAACATGGCGGGTGAGTTGTCA
CCTGTAGCTTCTAGGCAGCTACCGTTGACGAGATGGCGCAGCTTCCAACAAACTCGTTGCGCAGCTGAAATCAGA
ACTCACAGCGCAATCCACATTGGTGGATCAAACCGCACATCGGCTAGAGTGCAGCCAAACGAGTGGTGAAGGCCT
ACAGGCTGAAATTAATAAGCTGATCAAGTCACTCTCGGATGCAAGAGCAGAAGTTGCCATGCTATCGGCCAAACT
TGGTGCCAGCAAAAACTTCGAAGCCTCAGCGACGGACGCAGATAGTGTCGCGAAAGCCAACGCCACAGTTTCAGA
GGCCACAGTTCAAGATTCCAGGATACCCGAAGTGTCGCATGAAGCAAAAATCAAGGCAGATCTTTACAGCGACCT
GACTGGTCTTCTTTTCCAAGAACTAATACGCGGCGACGACGCAGACACAATTGGCTGCATTCAAACTGGTCGAAA
TGGGAGTATGTTGAGTGTCGAACGGCGGTGTAACGAATCTGCTGCGAGGCTGACGTCTTTTACAGCGTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail