Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5594
Gene name
LocationContig_280:17531..21479
Strand+
Gene length (bp)3948
Transcript length (bp)3756
Coding sequence length (bp)3756
Protein length (aa) 1252

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00550 PP-binding Phosphopantetheine attachment site 8.4E-10 307 367
PF00550 PP-binding Phosphopantetheine attachment site 5.8E-10 417 476
PF18558 HTH_51 Helix-turn-helix domain 1.1E-17 523 608
PF08242 Methyltransf_12 Methyltransferase domain 2.3E-16 712 811
PF13649 Methyltransf_25 Methyltransferase domain 1.6E-12 711 810
PF14765 PS-DH Polyketide synthase dehydratase 6.3E-13 2 248
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 3.3E-11 941 1061
PF08241 Methyltransf_11 Methyltransferase domain 5.5E-10 712 813
PF13847 Methyltransf_31 Methyltransferase domain 3.6E-10 709 818
PF13489 Methyltransf_23 Methyltransferase domain 7.0E-09 708 861
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 2.1E-06 703 821

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 674 861 3.0E-19
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 631 885 1.0E-18
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 92 469 2.0E-18
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 621 860 2.0E-16
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 651 884 8.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 674 861 3.0E-19
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 631 885 1.0E-18
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 92 469 2.0E-18
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 621 860 2.0E-16
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 651 884 8.0E-15
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 675 839 3.0E-12
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 711 861 3.0E-12
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 711 861 4.0E-12
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 673 839 2.0E-11
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 674 867 3.0E-11
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 585 860 1.0E-10
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 710 839 9.0E-10
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 710 839 1.0E-09
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 675 860 4.0E-07
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 674 868 4.0E-07
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 103 477 4.0E-06
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 630 853 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016787 hydrolase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 60 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-turn-helix

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5594
MALQQLLGDSSVTNNSLVFEQVHFQNALGLDPPGAVILSLEQGVSDLSWNFAIRTTVVAEPHSKEISHGHGVISI
LANPMLDMFERLVTGPMDRMAKNEDAERLMSKRAYGLFARVVEYDNFFRGIRSIAMDGQEAIATVALPETQPNRR
ESTAWKVCDTVSVDAFIQVLGLLMNTSDMISGDEVTVMVGLDRAVISTACRMEDVASWNVYTKFATTGDRQPVGD
VFVCSPQSKLVALLSGCRFANLPISKLERALDSANSGRSAERPETSRAAQVSSCASSSMPSGLQTPATDGSGPAA
GDLDMALKCLVAEYTGASHSDVSGEAVLSDLGLDSLASIELAGELASKFGLEMSSTDLMMCTLDRLSRLLGAFDL
SFLGANQSKSSTKASLGLAVLEENHAEPLGLQAKGRRQKFFEILADISGVRPEKISLDSTLADVGIDSLSSVDLK
QELEDEFAARIDDQLMVQTVGELLARLGMPESTSIAGTECDEPGSTVQAVPVPGSQDMERPLNLPNPLQLLRESD
VHFDDSAYQRGFLGYWAEVAPLQDELLLAYIVEGFSALGVDLRQIRCGEMVPQFSYLTHKYDKLVARLWEILKYH
GIVSINNAGDRMRSSRAVDPRPSSELQAAFEKRFPAYQDEASLIGLTGPRLADCLSGKEDAVAIMFGNAASLRIM
ENFYGRSPMMSTMTEQLVIYLTSLLRGVTVSRPVRILEVGAGTGGTTGRLAEALERYGIAARYTFTDISASLVSK
AKAKFKKYAWMEFSTFNLEKEVPEGFRNEFDVVISANCVHATTDRTASCRRLREALKPEGFMVLSEVTRIMDWYD
VCFGLLDGWWLVEDGSAYPLQPAEAWMSTFAAAGFASASYSEGPTAEANSQQLLVACNSHWDAPRPTMEDGNVDG
DTDGGVCQLETVVYKETNGIVIHADVFFPRQAPALPMPVALMIHGGGHMTLSRKAIRPAQTRHLISNGFLPVSID
YRLCPEVSLEDGPMADVCSAYGWVRTELPRMAAQRGLAVEGETVVVVGWSTGGHLAMSLGWTAERAGLPPPTAVL
SLYGPVDFESGELDSKRLPWLPGRAMSLERIMAALPTTPITGYDDSAKGDDTNLGWVRAGDARSELVLALFKEGI
GLPLLLDGLRGAASRLSADGGEKGSWLAAASAERVASISPLARLRAGQYKVPTYVIHGTADQVAPFAGAERFVRE
LGARGVEHGFLALQGVDHIHDLRLRPGSEAWAAQVEPGYEFLFRLAGRRKL*
Coding >Hirsu2|5594
ATGGCTCTGCAACAGCTCTTGGGCGACTCAAGTGTAACCAACAACAGCCTTGTGTTTGAACAAGTCCATTTCCAA
AACGCGCTCGGCTTAGATCCTCCGGGGGCGGTCATCCTGAGTCTAGAGCAAGGAGTCAGCGACCTGTCATGGAAC
TTCGCCATCCGTACGACTGTCGTGGCCGAGCCACACTCCAAGGAGATATCACACGGGCATGGCGTGATATCGATC
CTGGCGAACCCCATGCTTGATATGTTCGAAAGACTGGTCACTGGGCCCATGGACCGAATGGCGAAAAATGAAGAC
GCAGAAAGGCTCATGTCAAAGCGCGCGTACGGGCTCTTCGCTCGAGTCGTGGAGTACGACAACTTCTTCCGAGGC
ATTCGGTCGATCGCAATGGACGGCCAGGAAGCCATAGCAACTGTGGCTCTTCCCGAAACGCAGCCCAATAGGAGA
GAAAGCACGGCCTGGAAAGTCTGTGACACAGTATCTGTCGACGCATTCATTCAAGTGCTCGGCCTCCTCATGAAT
ACCAGCGATATGATATCTGGCGATGAGGTCACGGTCATGGTCGGTCTTGATCGCGCCGTAATATCCACCGCATGC
AGGATGGAGGATGTGGCCAGCTGGAACGTATACACCAAGTTTGCGACCACGGGCGATCGACAGCCAGTTGGCGAT
GTATTCGTCTGCTCTCCTCAAAGCAAACTAGTGGCGCTCTTGAGCGGATGCCGGTTTGCTAATCTTCCCATATCC
AAGCTCGAGAGGGCCTTGGACTCGGCCAACTCGGGCAGAAGCGCAGAGAGACCCGAGACGAGTCGGGCTGCTCAG
GTGAGCTCCTGCGCCTCCAGCTCTATGCCCAGCGGCCTGCAGACGCCGGCGACGGATGGCTCTGGCCCGGCCGCT
GGCGATCTGGACATGGCCCTTAAATGCCTCGTAGCCGAGTACACGGGCGCCAGTCACTCTGATGTCTCTGGCGAG
GCGGTTCTGTCGGACCTCGGCCTCGACTCTCTGGCATCGATCGAGCTGGCCGGAGAGCTTGCTTCCAAGTTCGGT
CTCGAGATGAGTTCGACTGATTTGATGATGTGCACCTTGGACCGTCTGAGCAGGCTCCTCGGCGCCTTTGACCTG
TCGTTCTTGGGCGCAAATCAGTCGAAATCTTCGACCAAGGCGTCACTAGGCTTGGCGGTTTTGGAGGAAAACCAT
GCCGAGCCACTTGGTCTGCAAGCCAAGGGTCGCCGTCAAAAGTTTTTTGAGATTCTAGCCGACATTTCGGGTGTC
CGACCTGAGAAAATCAGTCTCGACAGCACATTAGCCGACGTCGGCATCGACTCGCTTTCATCGGTAGACCTCAAG
CAGGAGCTCGAAGATGAATTCGCGGCACGCATAGACGACCAGTTGATGGTTCAGACAGTCGGGGAACTCCTGGCT
CGACTTGGGATGCCGGAGTCCACGAGTATTGCTGGCACAGAGTGTGACGAGCCCGGATCCACTGTTCAGGCGGTC
CCCGTCCCTGGCTCGCAGGACATGGAAAGGCCGCTCAATTTGCCGAATCCCTTGCAGCTGCTCAGAGAGTCAGAT
GTCCACTTTGACGACTCGGCTTACCAGAGAGGCTTCCTCGGCTACTGGGCGGAAGTTGCGCCTCTGCAGGACGAG
CTACTCCTTGCCTACATCGTAGAGGGCTTCTCCGCCCTCGGTGTCGATCTGAGACAAATCCGGTGCGGTGAAATG
GTACCGCAATTCTCCTATCTGACGCACAAATACGACAAACTCGTTGCGAGATTGTGGGAAATTCTGAAATATCAC
GGGATCGTGTCCATCAACAACGCAGGCGATAGGATGCGGAGCAGTCGTGCCGTCGATCCACGCCCGTCTTCTGAG
CTGCAGGCCGCTTTCGAGAAGCGGTTCCCCGCCTACCAGGACGAGGCCAGCCTCATTGGCCTGACTGGACCGAGA
CTGGCGGATTGCCTGAGTGGGAAGGAAGACGCGGTCGCGATCATGTTCGGCAATGCTGCGTCTCTGAGGATCATG
GAAAACTTCTACGGCCGATCACCGATGATGTCTACGATGACGGAGCAGCTTGTCATCTACCTGACGAGCCTCTTG
AGAGGCGTCACCGTTTCCCGTCCGGTGCGAATTCTCGAAGTCGGTGCCGGTACGGGGGGGACAACCGGCAGGCTG
GCAGAGGCTCTTGAGCGCTACGGCATCGCGGCCCGATATACCTTTACCGACATCTCGGCCAGCCTCGTGTCTAAA
GCAAAGGCCAAATTCAAGAAGTATGCTTGGATGGAATTTTCGACGTTCAACCTGGAGAAGGAAGTGCCGGAGGGG
TTCCGCAACGAGTTCGACGTCGTCATCAGCGCCAACTGCGTCCACGCGACGACGGATCGGACAGCGTCGTGCCGG
CGGCTGAGGGAAGCGCTGAAGCCGGAAGGGTTCATGGTTCTGTCCGAGGTCACGCGCATCATGGACTGGTACGAT
GTCTGCTTCGGCCTCCTGGACGGATGGTGGCTGGTCGAGGACGGAAGCGCGTACCCTCTTCAGCCTGCCGAGGCG
TGGATGTCGACCTTTGCCGCTGCCGGCTTCGCCTCGGCGAGCTACTCGGAGGGACCGACAGCGGAAGCCAACAGC
CAACAGCTGCTCGTGGCTTGCAACAGCCACTGGGACGCCCCTCGGCCTACGATGGAAGACGGCAACGTCGATGGA
GACACGGACGGTGGTGTCTGCCAACTGGAGACGGTGGTGTACAAGGAGACGAACGGCATTGTAATCCATGCCGAC
GTCTTCTTCCCAAGACAGGCTCCGGCCTTGCCCATGCCCGTTGCTCTCATGATACACGGCGGGGGTCACATGACG
CTCTCGCGCAAAGCGATCCGACCCGCGCAAACGAGACACCTTATCTCGAACGGGTTCCTGCCTGTGAGCATCGAC
TACAGGCTATGCCCCGAAGTGAGCCTGGAGGATGGGCCCATGGCGGACGTGTGCAGCGCCTACGGGTGGGTACGT
ACCGAGCTTCCACGGATGGCAGCCCAGCGCGGCCTCGCGGTCGAAGGGGAGACGGTCGTGGTTGTCGGGTGGTCT
ACGGGCGGGCATCTGGCCATGTCGCTGGGCTGGACGGCGGAGAGGGCGGGCCTGCCGCCGCCTACGGCGGTGTTG
AGCCTGTACGGGCCTGTCGACTTTGAATCGGGCGAGCTCGACTCGAAGCGTCTGCCATGGTTGCCCGGTCGGGCC
ATGAGCTTGGAGCGCATCATGGCCGCCTTGCCGACGACGCCGATAACCGGCTACGACGATTCCGCCAAGGGCGAC
GACACCAATCTGGGCTGGGTACGAGCCGGGGACGCGCGCTCCGAGCTCGTGCTGGCACTCTTCAAGGAGGGCATC
GGGCTTCCGCTCTTGCTCGACGGCCTGCGCGGGGCCGCGTCTCGTCTTTCGGCCGACGGCGGCGAGAAGGGCAGC
TGGTTGGCGGCGGCGTCGGCGGAGCGCGTCGCGTCCATCAGCCCTCTGGCGCGGCTGCGGGCCGGGCAGTACAAG
GTGCCCACGTACGTGATCCACGGCACGGCCGACCAGGTGGCCCCGTTCGCGGGGGCGGAGAGGTTTGTCCGGGAG
CTCGGGGCAAGGGGCGTGGAGCACGGGTTCCTTGCATTGCAGGGCGTTGATCACATTCACGATCTGAGGCTGCGG
CCGGGCAGCGAGGCGTGGGCGGCGCAGGTCGAGCCCGGATATGAGTTTCTGTTCCGGCTGGCCGGTAGGAGGAAG
CTGTGA
Transcript >Hirsu2|5594
ATGGCTCTGCAACAGCTCTTGGGCGACTCAAGTGTAACCAACAACAGCCTTGTGTTTGAACAAGTCCATTTCCAA
AACGCGCTCGGCTTAGATCCTCCGGGGGCGGTCATCCTGAGTCTAGAGCAAGGAGTCAGCGACCTGTCATGGAAC
TTCGCCATCCGTACGACTGTCGTGGCCGAGCCACACTCCAAGGAGATATCACACGGGCATGGCGTGATATCGATC
CTGGCGAACCCCATGCTTGATATGTTCGAAAGACTGGTCACTGGGCCCATGGACCGAATGGCGAAAAATGAAGAC
GCAGAAAGGCTCATGTCAAAGCGCGCGTACGGGCTCTTCGCTCGAGTCGTGGAGTACGACAACTTCTTCCGAGGC
ATTCGGTCGATCGCAATGGACGGCCAGGAAGCCATAGCAACTGTGGCTCTTCCCGAAACGCAGCCCAATAGGAGA
GAAAGCACGGCCTGGAAAGTCTGTGACACAGTATCTGTCGACGCATTCATTCAAGTGCTCGGCCTCCTCATGAAT
ACCAGCGATATGATATCTGGCGATGAGGTCACGGTCATGGTCGGTCTTGATCGCGCCGTAATATCCACCGCATGC
AGGATGGAGGATGTGGCCAGCTGGAACGTATACACCAAGTTTGCGACCACGGGCGATCGACAGCCAGTTGGCGAT
GTATTCGTCTGCTCTCCTCAAAGCAAACTAGTGGCGCTCTTGAGCGGATGCCGGTTTGCTAATCTTCCCATATCC
AAGCTCGAGAGGGCCTTGGACTCGGCCAACTCGGGCAGAAGCGCAGAGAGACCCGAGACGAGTCGGGCTGCTCAG
GTGAGCTCCTGCGCCTCCAGCTCTATGCCCAGCGGCCTGCAGACGCCGGCGACGGATGGCTCTGGCCCGGCCGCT
GGCGATCTGGACATGGCCCTTAAATGCCTCGTAGCCGAGTACACGGGCGCCAGTCACTCTGATGTCTCTGGCGAG
GCGGTTCTGTCGGACCTCGGCCTCGACTCTCTGGCATCGATCGAGCTGGCCGGAGAGCTTGCTTCCAAGTTCGGT
CTCGAGATGAGTTCGACTGATTTGATGATGTGCACCTTGGACCGTCTGAGCAGGCTCCTCGGCGCCTTTGACCTG
TCGTTCTTGGGCGCAAATCAGTCGAAATCTTCGACCAAGGCGTCACTAGGCTTGGCGGTTTTGGAGGAAAACCAT
GCCGAGCCACTTGGTCTGCAAGCCAAGGGTCGCCGTCAAAAGTTTTTTGAGATTCTAGCCGACATTTCGGGTGTC
CGACCTGAGAAAATCAGTCTCGACAGCACATTAGCCGACGTCGGCATCGACTCGCTTTCATCGGTAGACCTCAAG
CAGGAGCTCGAAGATGAATTCGCGGCACGCATAGACGACCAGTTGATGGTTCAGACAGTCGGGGAACTCCTGGCT
CGACTTGGGATGCCGGAGTCCACGAGTATTGCTGGCACAGAGTGTGACGAGCCCGGATCCACTGTTCAGGCGGTC
CCCGTCCCTGGCTCGCAGGACATGGAAAGGCCGCTCAATTTGCCGAATCCCTTGCAGCTGCTCAGAGAGTCAGAT
GTCCACTTTGACGACTCGGCTTACCAGAGAGGCTTCCTCGGCTACTGGGCGGAAGTTGCGCCTCTGCAGGACGAG
CTACTCCTTGCCTACATCGTAGAGGGCTTCTCCGCCCTCGGTGTCGATCTGAGACAAATCCGGTGCGGTGAAATG
GTACCGCAATTCTCCTATCTGACGCACAAATACGACAAACTCGTTGCGAGATTGTGGGAAATTCTGAAATATCAC
GGGATCGTGTCCATCAACAACGCAGGCGATAGGATGCGGAGCAGTCGTGCCGTCGATCCACGCCCGTCTTCTGAG
CTGCAGGCCGCTTTCGAGAAGCGGTTCCCCGCCTACCAGGACGAGGCCAGCCTCATTGGCCTGACTGGACCGAGA
CTGGCGGATTGCCTGAGTGGGAAGGAAGACGCGGTCGCGATCATGTTCGGCAATGCTGCGTCTCTGAGGATCATG
GAAAACTTCTACGGCCGATCACCGATGATGTCTACGATGACGGAGCAGCTTGTCATCTACCTGACGAGCCTCTTG
AGAGGCGTCACCGTTTCCCGTCCGGTGCGAATTCTCGAAGTCGGTGCCGGTACGGGGGGGACAACCGGCAGGCTG
GCAGAGGCTCTTGAGCGCTACGGCATCGCGGCCCGATATACCTTTACCGACATCTCGGCCAGCCTCGTGTCTAAA
GCAAAGGCCAAATTCAAGAAGTATGCTTGGATGGAATTTTCGACGTTCAACCTGGAGAAGGAAGTGCCGGAGGGG
TTCCGCAACGAGTTCGACGTCGTCATCAGCGCCAACTGCGTCCACGCGACGACGGATCGGACAGCGTCGTGCCGG
CGGCTGAGGGAAGCGCTGAAGCCGGAAGGGTTCATGGTTCTGTCCGAGGTCACGCGCATCATGGACTGGTACGAT
GTCTGCTTCGGCCTCCTGGACGGATGGTGGCTGGTCGAGGACGGAAGCGCGTACCCTCTTCAGCCTGCCGAGGCG
TGGATGTCGACCTTTGCCGCTGCCGGCTTCGCCTCGGCGAGCTACTCGGAGGGACCGACAGCGGAAGCCAACAGC
CAACAGCTGCTCGTGGCTTGCAACAGCCACTGGGACGCCCCTCGGCCTACGATGGAAGACGGCAACGTCGATGGA
GACACGGACGGTGGTGTCTGCCAACTGGAGACGGTGGTGTACAAGGAGACGAACGGCATTGTAATCCATGCCGAC
GTCTTCTTCCCAAGACAGGCTCCGGCCTTGCCCATGCCCGTTGCTCTCATGATACACGGCGGGGGTCACATGACG
CTCTCGCGCAAAGCGATCCGACCCGCGCAAACGAGACACCTTATCTCGAACGGGTTCCTGCCTGTGAGCATCGAC
TACAGGCTATGCCCCGAAGTGAGCCTGGAGGATGGGCCCATGGCGGACGTGTGCAGCGCCTACGGGTGGGTACGT
ACCGAGCTTCCACGGATGGCAGCCCAGCGCGGCCTCGCGGTCGAAGGGGAGACGGTCGTGGTTGTCGGGTGGTCT
ACGGGCGGGCATCTGGCCATGTCGCTGGGCTGGACGGCGGAGAGGGCGGGCCTGCCGCCGCCTACGGCGGTGTTG
AGCCTGTACGGGCCTGTCGACTTTGAATCGGGCGAGCTCGACTCGAAGCGTCTGCCATGGTTGCCCGGTCGGGCC
ATGAGCTTGGAGCGCATCATGGCCGCCTTGCCGACGACGCCGATAACCGGCTACGACGATTCCGCCAAGGGCGAC
GACACCAATCTGGGCTGGGTACGAGCCGGGGACGCGCGCTCCGAGCTCGTGCTGGCACTCTTCAAGGAGGGCATC
GGGCTTCCGCTCTTGCTCGACGGCCTGCGCGGGGCCGCGTCTCGTCTTTCGGCCGACGGCGGCGAGAAGGGCAGC
TGGTTGGCGGCGGCGTCGGCGGAGCGCGTCGCGTCCATCAGCCCTCTGGCGCGGCTGCGGGCCGGGCAGTACAAG
GTGCCCACGTACGTGATCCACGGCACGGCCGACCAGGTGGCCCCGTTCGCGGGGGCGGAGAGGTTTGTCCGGGAG
CTCGGGGCAAGGGGCGTGGAGCACGGGTTCCTTGCATTGCAGGGCGTTGATCACATTCACGATCTGAGGCTGCGG
CCGGGCAGCGAGGCGTGGGCGGCGCAGGTCGAGCCCGGATATGAGTTTCTGTTCCGGCTGGCCGGTAGGAGGAAG
CTGTGA
Gene >Hirsu2|5594
ATGGCTCTGCAACAGCTCTTGGGCGACTCAAGTGTAACCAACAACAGCCTTGTGTTTGAACAAGTCCATTTCCAA
AACGCGCTCGGCTTAGATCCTCCGGGGGCGGTCATCCTGAGTCTAGAGCAAGGAGTCAGCGACCTGTCATGGAAC
TTCGCCATCCGTACGACTGTCGTGGCCGAGCCACACTCCAAGGAGATATCACACGGGCATGGCGTGATATCGATC
CTGGCGAACCCCATGCTTGATATGTTCGAAAGACTGGTCACTGGGCCCATGGACCGAATGGCGAAAAATGAAGAC
GCAGAAAGGCTCATGTCAAAGCGCGCGTACGGGCTCTTCGCTCGAGTCGTGGAGTACGACAACTTCTTCCGAGGC
ATTCGGTCGATCGCAATGGACGGCCAGGAAGCCATAGCAACTGTGGCTCTTCCCGAAACGCAGCCCAATAGGAGA
GAAAGCACGGCCTGGAAAGTCTGTGACACAGTATCTGTCGACGCATTCATTCAAGTGCTCGGCCTCCTCATGAAT
ACCAGCGATATGATATCTGGCGATGAGGTCACGGTCATGGTCGGTCTTGATCGCGCCGTAATATCCACCGCATGC
AGGATGGAGGATGTGGCCAGCTGGAACGTATACACCAAGTTTGCGACCACGGGCGATCGACAGCCAGTTGGCGAT
GTATTCGTCTGCTCTCCTCAAAGCAAACTAGTGGCGCTCTTGAGCGGATGCCGGTTTGCTAATCTTCCCATATCC
AAGCTCGAGAGGGCCTTGGACTCGGCCAACTCGGGCAGAAGCGCAGAGAGACCCGAGACGAGTCGGGCTGCTCAG
GTGAGCTCCTGCGCCTCCAGCTCTATGCCCAGCGGCCTGCAGACGCCGGCGACGGATGGCTCTGGCCCGGCCGCT
GGCGATCTGGACATGGCCCTTAAATGCCTCGTAGCCGAGTACACGGGCGCCAGTCACTCTGATGTCTCTGGCGAG
GCGGTTCTGTCGGACCTCGGCCTCGACTCTCTGGCATCGATCGAGCTGGCCGGAGAGCTTGCTTCCAAGTTCGGT
CTCGAGATGAGTTCGACTGATTTGATGATGTGCACCTTGGACCGTCTGAGCAGGCTCCTCGGCGCCTTTGACCTG
TCGTTCTTGGGCGCAAATCAGTCGAAATCTTCGACCAAGGCGTCACTAGGCTTGGCGGTTTTGGAGGAAAACCAT
GCCGAGCCACTTGGTCTGCAAGCCAAGGGTCGCCGTCAAAAGTTTTTTGAGATTCTAGCCGACATTTCGGGTGTC
CGACCTGAGAAAATCAGTCTCGACAGCACATTAGCCGACGTCGGCATCGACTCGCTTTCATCGGTAGACCTCAAG
CAGGAGCTCGAAGATGAATTCGCGGCACGCATAGACGACCAGTTGATGGTTCAGACAGTCGGGGAACTCCTGGCT
CGACTTGGGATGCCGGAGTCCACGAGTATTGCTGGCACAGAGTGTGACGAGCCCGGATCCACTGTTCAGGCGGTC
CCCGTCCCTGGCTCGCAGGACATGGAAAGGCCGCTCAATTTGCCGAATCCCTTGCAGCTGCTCAGAGAGTCAGAT
GTCCACTTTGACGACTCGGCTTACCAGAGAGGCTTCCTCGGCTACTGGGCGGAAGTTGCGCCTCTGCAGGACGAG
CTACTCCTTGCCTACATCGTAGAGGGCTTCTCCGCCCTCGGTGTCGATCTGAGACAAATCCGGTGCGGTGAAATG
GTACCGCAATTCTCCTATCTGACGCACAAATACGACAAACTCGTTGCGAGATTGTGGGAAATTCTGAAATATCAC
GGGATCGTGTCCATCAACAACGCAGGCGATAGGATGCGGAGCAGTCGTGCCGTCGATCCACGCCCGTCTTCTGAG
CTGCAGGCCGCTTTCGAGAAGCGGTTCCCCGCCTACCAGGACGAGGCCAGCCTCATTGGCCTGACTGGACCGAGA
CTGGCGGATTGCCTGAGTGGGAAGGAAGACGCGGTCGCGATCATGTTCGGCAATGCTGCGTCTCTGAGGATCATG
GAAAACTTCTACGGCCGATCACCGATGATGTCTACGATGACGGAGCAGCTTGTCATCTACCTGACGAGCCTCTTG
AGAGGCGTCACCGTTTCCCGTCCGGTGCGAATTCTCGAAGTCGGTGCCGGTACGGGGGGGACAACCGGCAGGCTG
GCAGAGGCTCTTGAGCGCTACGGCATCGCGGCCCGATATACCTTTACCGACATCTCGGCCAGCCTCGTGTCTAAA
GCAAAGGCCAAATTCAAGAAGTATGCTTGGATGGAATTTTCGACGTTCAACCTGGAGAAGGAAGTGCCGGAGGGG
TTCCGCAACGAGTTCGACGTCGTCATCAGCGCCAACTGCGTCCACGCGACGACGGATCGGACAGCGTCGTGCCGG
CGGCTGAGGGAAGCGCTGAAGCCGGAAGGGTTCATGGTTCTGTCCGAGGTCACGCGCATCATGGACTGGTACGAT
GTCTGCTTCGGCCTCCTGGACGGATGGTGGCTGGTCGAGGACGGAAGCGCGTACCCTCTTCAGCCTGCCGAGGCG
TGGATGTCGACCTTTGCCGCTGCCGGCTTCGCCTCGGCGAGCTACTCGGAGGGACCGACAGCGGAAGCCAACAGC
CAACAGCTGCTCGTGGCTTGCAACAGCCACTGGGACGCCCCTCGGCCTACGATGGAAGACGGCAACGTCGATGGA
GACACGGACGGTGGTGTCTGCCAACTGGAGACGGTGGTGTACAAGGAGACGAACGGCATTGTAATCCATGCCGAC
GTCTTCTTCCCAAGACAGGCTCCGGCCTTGCCCATGCCCGTTGGTACGGAGGCCCTCTCTTCCTCTCCCCGCGTC
GAGGTCTGAGCCTGTCAGTTGCTCACACGGGCCATGTCCGATAGCTCTCATGATACACGGCGGGGGTCACATGAC
GCTCTCGCGCAAAGCGATCCGACCCGCGCAAACGAGACACCTTATCTCGAACGGGTTCCTGCCTGTGAGCATCGA
CTACAGGCTATGCCCCGAAGTGAGCCTGGAGGATGGGCCCATGGCGGACGTGTGCAGCGCCTACGGGTGGGTACG
TACCGAGCTTCCACGGATGGCAGCCCAGCGCGGCCTCGCGGTCGAAGGGGAGACGGTCGTGGTTGTCGGGTGGTC
TACGGGCGGGCATCTGGCCATGTCGCTGGGCTGGACGGCGGAGAGGGCGGGCCTGCCGCCGCCTACGGCGGTGTT
GAGCCTGTACGGGCCTGTCGACTTTGAATCGGGCGGTGAGTGAGCTGTTTGAGAGTGGAGGTTGAGGGAGAGGGC
CTGAGGCTGACGGCCGTTGCACAGAGCTCGACTCGAAGCGTCTGCCATGGTTGCCCGGTCGGGCCATGAGCTTGG
AGCGCATCATGGCCGCCTTGCCGACGACGCCGGTGAGTGAGGTTGCGATCCACTGGGTAGTGAGGTTGCTGACGG
TAAAGACAGATAACCGGCTACGACGATTCCGCCAAGGGCGACGACACCAATCTGGGCTGGGTACGAGCCGGGGAC
GCGCGCTCCGAGCTCGTGCTGGCACTCTTCAAGGAGGGCATCGGGCTTCCGCTCTTGCTCGACGGCCTGCGCGGG
GCCGCGTCTCGTCTTTCGGCCGACGGCGGCGAGAAGGGCAGCTGGTTGGCGGCGGCGTCGGCGGAGCGCGTCGCG
TCCATCAGCCCTCTGGCGCGGCTGCGGGCCGGGCAGTACAAGGTGCCCACGTACGTGATCCACGGCACGGCCGAC
CAGGTGGCCCCGTTCGCGGGGGCGGAGAGGTTTGTCCGGGAGCTCGGGGCAAGGGGCGTGGAGCACGGGTTCCTT
GCATTGCAGGGCGTTGATCACATTCACGATCTGAGGCTGCGGCCGGGCAGCGAGGCGTGGGCGGCGCAGGTCGAG
CCCGGATATGAGTTTCTGTTCCGGCTGGCCGGTAGGAGGAAGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail