Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5591
Gene name
LocationContig_280:8694..10570
Strand+
Gene length (bp)1876
Transcript length (bp)1491
Coding sequence length (bp)1491
Protein length (aa) 497

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 4.3E-23 68 200
PF08031 BBE Berberine and berberine like 1.6E-04 445 482

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 75 484 6.0E-21
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 48 481 1.0E-16
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 73 480 9.0E-12
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 57 247 1.0E-11
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 62 310 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 75 484 6.0E-21
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 48 481 1.0E-16
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 73 480 9.0E-12
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 57 247 1.0E-11
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 62 310 1.0E-11
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 75 230 9.0E-11
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 39 482 7.0E-10
sp|P46377|FAS5_RHOFA Uncharacterized oxidoreductase ORF5 in fasciation locus OS=Rhodococcus fascians GN=fas5 PE=2 SV=1 71 225 1.0E-07
sp|Q6YW51|CKX6_ORYSJ Cytokinin dehydrogenase 6 OS=Oryza sativa subsp. japonica GN=CKX6 PE=3 SV=1 65 239 4.0E-07
sp|Q6YW50|CKX7_ORYSJ Cytokinin dehydrogenase 7 OS=Oryza sativa subsp. japonica GN=CKX7 PE=3 SV=1 65 239 8.0E-07
sp|Q9LY71|CKX6_ARATH Cytokinin dehydrogenase 6 OS=Arabidopsis thaliana GN=CKX6 PE=2 SV=2 49 231 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0050662 coenzyme binding No
GO:0005488 binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5591
MVSILSLVLGLACLCHVSLALSGEQVVQDLQRRLSPGSKVVLASDAAFAKDFTPRFSITTPPVFVVAAKPRLVTD
VQQIVRYASRNHVPFLATGGGHGYSSTLGRLRHGILLDLGHFDAVEVDAAANTMTVGGAARSVNVSSAVQAAGKE
IPVGQCICIGYAGATMGGGIGPYSGLYGTQSDSLLSAEMVTGTGDIVTVSEAEHPDLFYAVKGAGFNYGIATSLT
YAVYPATNGGRAVNADMIFPGHLNGSVWRLAASFVGRQPKELSITLAVGYDPKLGGLFLIGNFIYAGPRAQGLDL
IQPFLDLKPLNVSISTVEWKDVPAKAVYGHTLAGCTPGAHYVPFAANLYRVDVPSLVSLANYMDEAMSADPALRS
TIIAWAQYAPHGFQRHADASSAFPHRDAVVFAQIDGFAEQAAQVPALARFGRDLRRRLQRASGRDALAVYAHFAH
GDEAPEAWYSASRLARLRALKAVYDPENLFSYYNPVLGRSGCRAGA*
Coding >Hirsu2|5591
ATGGTTTCCATCTTGTCTCTGGTTCTGGGACTCGCGTGTCTCTGCCACGTCTCGCTGGCTCTCTCCGGGGAGCAG
GTCGTCCAGGATCTGCAGCGTCGCCTCTCGCCCGGGTCCAAAGTCGTCTTGGCCTCGGATGCAGCCTTTGCCAAG
GACTTCACTCCGCGCTTCTCCATCACGACACCGCCCGTCTTTGTCGTTGCCGCAAAGCCTCGACTCGTCACCGAC
GTTCAGCAGATTGTTCGATATGCGTCCCGCAATCATGTGCCGTTCCTGGCGACGGGCGGCGGCCATGGTTACTCG
TCGACCCTGGGCCGGCTGCGGCACGGCATCCTCCTCGACCTGGGCCACTTTGACGCCGTCGAGGTCGATGCCGCC
GCCAATACCATGACCGTCGGCGGTGCGGCACGGAGCGTCAACGTCTCCAGCGCTGTCCAGGCGGCTGGCAAGGAG
ATTCCCGTGGGACAATGCATCTGCATCGGCTACGCCGGCGCCACCATGGGCGGCGGCATCGGCCCTTACTCCGGG
CTCTACGGGACGCAGTCCGACTCGCTCCTCTCGGCGGAGATGGTGACGGGCACGGGCGACATCGTCACCGTCTCC
GAGGCCGAGCACCCGGACCTCTTCTACGCCGTCAAGGGCGCCGGCTTCAACTACGGCATCGCCACCTCCCTGACC
TACGCCGTCTACCCCGCCACCAACGGCGGCCGGGCCGTCAACGCCGACATGATCTTCCCGGGCCACCTCAATGGC
TCCGTCTGGCGGCTGGCCGCGTCCTTCGTCGGCAGGCAGCCCAAGGAGCTCAGCATCACCCTGGCCGTCGGCTAC
GACCCCAAGCTCGGCGGCCTCTTCCTCATCGGCAACTTCATCTACGCCGGGCCCCGGGCCCAGGGCCTCGACCTG
ATACAGCCGTTCCTCGACCTCAAGCCCCTCAACGTCAGCATCTCGACCGTCGAGTGGAAAGACGTACCGGCCAAG
GCCGTCTACGGCCACACCCTGGCCGGCTGCACGCCGGGGGCCCATTACGTGCCCTTCGCCGCCAACCTGTACAGG
GTGGACGTGCCGAGCCTCGTCAGCCTCGCCAACTACATGGACGAGGCCATGTCCGCCGACCCGGCCCTGCGGTCG
ACCATCATCGCCTGGGCCCAGTACGCGCCGCACGGCTTCCAGCGGCACGCGGATGCCTCTTCCGCCTTTCCCCAC
CGCGATGCCGTCGTCTTTGCTCAGATCGACGGCTTCGCCGAGCAGGCGGCGCAGGTGCCCGCCCTGGCGCGCTTC
GGCCGGGACCTGCGCCGCAGGCTGCAACGGGCCAGCGGCCGGGACGCGCTCGCCGTCTACGCCCACTTCGCCCAC
GGCGACGAGGCGCCCGAGGCCTGGTACTCGGCTTCCCGCCTGGCGCGGCTGAGGGCCCTCAAGGCCGTCTACGAC
CCGGAAAACCTCTTCTCCTACTACAACCCCGTCCTCGGGCGGTCGGGCTGCCGCGCGGGGGCTTGA
Transcript >Hirsu2|5591
ATGGTTTCCATCTTGTCTCTGGTTCTGGGACTCGCGTGTCTCTGCCACGTCTCGCTGGCTCTCTCCGGGGAGCAG
GTCGTCCAGGATCTGCAGCGTCGCCTCTCGCCCGGGTCCAAAGTCGTCTTGGCCTCGGATGCAGCCTTTGCCAAG
GACTTCACTCCGCGCTTCTCCATCACGACACCGCCCGTCTTTGTCGTTGCCGCAAAGCCTCGACTCGTCACCGAC
GTTCAGCAGATTGTTCGATATGCGTCCCGCAATCATGTGCCGTTCCTGGCGACGGGCGGCGGCCATGGTTACTCG
TCGACCCTGGGCCGGCTGCGGCACGGCATCCTCCTCGACCTGGGCCACTTTGACGCCGTCGAGGTCGATGCCGCC
GCCAATACCATGACCGTCGGCGGTGCGGCACGGAGCGTCAACGTCTCCAGCGCTGTCCAGGCGGCTGGCAAGGAG
ATTCCCGTGGGACAATGCATCTGCATCGGCTACGCCGGCGCCACCATGGGCGGCGGCATCGGCCCTTACTCCGGG
CTCTACGGGACGCAGTCCGACTCGCTCCTCTCGGCGGAGATGGTGACGGGCACGGGCGACATCGTCACCGTCTCC
GAGGCCGAGCACCCGGACCTCTTCTACGCCGTCAAGGGCGCCGGCTTCAACTACGGCATCGCCACCTCCCTGACC
TACGCCGTCTACCCCGCCACCAACGGCGGCCGGGCCGTCAACGCCGACATGATCTTCCCGGGCCACCTCAATGGC
TCCGTCTGGCGGCTGGCCGCGTCCTTCGTCGGCAGGCAGCCCAAGGAGCTCAGCATCACCCTGGCCGTCGGCTAC
GACCCCAAGCTCGGCGGCCTCTTCCTCATCGGCAACTTCATCTACGCCGGGCCCCGGGCCCAGGGCCTCGACCTG
ATACAGCCGTTCCTCGACCTCAAGCCCCTCAACGTCAGCATCTCGACCGTCGAGTGGAAAGACGTACCGGCCAAG
GCCGTCTACGGCCACACCCTGGCCGGCTGCACGCCGGGGGCCCATTACGTGCCCTTCGCCGCCAACCTGTACAGG
GTGGACGTGCCGAGCCTCGTCAGCCTCGCCAACTACATGGACGAGGCCATGTCCGCCGACCCGGCCCTGCGGTCG
ACCATCATCGCCTGGGCCCAGTACGCGCCGCACGGCTTCCAGCGGCACGCGGATGCCTCTTCCGCCTTTCCCCAC
CGCGATGCCGTCGTCTTTGCTCAGATCGACGGCTTCGCCGAGCAGGCGGCGCAGGTGCCCGCCCTGGCGCGCTTC
GGCCGGGACCTGCGCCGCAGGCTGCAACGGGCCAGCGGCCGGGACGCGCTCGCCGTCTACGCCCACTTCGCCCAC
GGCGACGAGGCGCCCGAGGCCTGGTACTCGGCTTCCCGCCTGGCGCGGCTGAGGGCCCTCAAGGCCGTCTACGAC
CCGGAAAACCTCTTCTCCTACTACAACCCCGTCCTCGGGCGGTCGGGCTGCCGCGCGGGGGCTTGA
Gene >Hirsu2|5591
ATGGTTTCCATCTTGTCTCTGGTTCTGGGACTCGCGTGTCTCTGCCACGTCTCGCTGGCTCTCTCCGGGGAGCAG
GTCGTCCAGGATCTGCAGCGTCGCCTCTCGCCCGGGTCCAAAGTCGTCTTGGCCTCGGATGCAGCCTTTGCCAAG
GACTTCACTCCGCGCTTCTCCATCACGACACCGCCCGTCTTTGTCGTTGCCGCAAAGCCTCGACTCGTCACCGAC
GTTCAGCAGATTGTAACTTGGCCCCCCTTGCCCTTTCACTCCCTCCCCTGCCAGCATGATGCCGCTTGGGACGGC
CGTCGGAACAGGATCCCCTGGTTCTCCCTCCCGCCGTCCCTGGTTCCCCTATCACCTGCCGTCTCTCTCTCGGCC
TCGGCCCAGCTGACGCGCCTCCAGGTTCGATATGCGTCCCGCAATCATGTGCCGTTCCTGGCGACGGGCGGCGGC
CATGGTTACTCGTCGACCCTGGGCCGGCTGCGGCACGGCATCCTCCTCGACCTGGGCCACTTTGACGCCGTCGAG
GTCGATGCCGCCGCCAATACCATGACCGTCGGCGGTGCGGCACGGAGCGTCAACGTCTCCAGCGCTGTCCAGGCG
GCTGGCAAGGAGATTCGTAGGTCATCCGCCACAGTTTGCTTTTGGTTGCCCGCGGAGCCGTCGTAGCTAAGACCT
CGGGCCCCTGCTCGTCGCGCACTTCAGCCGTGGGACAATGCATCTGCATCGGCTACGCCGGCGCCACCATGGGCG
GCGGCATCGGCCCTTACTCCGGGCTCTACGGGACGCAGTCCGACTCGCTCCTCTCGGCGGAGATGGTGACGGGCA
CGGGCGACATCGTCACCGTCTCCGAGGCCGAGCACCCGGACCTCTTCTACGCCGTCAAGGGCGCCGGCTTCAACT
ACGGCATCGCCACCTCCCTGACCTACGCCGTCTACCCCGCCACCAACGGCGGCCGGGCCGTCAACGCCGACATGA
TCTTCCCGGGCCACCTCAATGGCTCCGTCTGGCGGCTGGCCGCGTCCTTCGTCGGCAGGCAGCCCAAGGAGCTCA
GCATCACCCTGGCCGTCGGCTACGACCCCAAGCTCGGCGGCCTCTTCCTCATCGGCAACTTCATCTACGCCGGGC
CCCGGGCCCAGGGCCTCGACCTGATACAGCCGTTCCTCGACCTCAAGCCCCTCAACGTCAGCATCTCGACCGTCG
AGTGGAAAGACGTACCGGCCAAGGCCGTCTACGGCCACACCCTGGCCGGCTGCACGCCGGGGGCCCATTACGTGC
CCTTCGCCGCCAACCTGTACAGGGTGGACGTGCCGAGCCTCGTCAGCCTCGCCAACTACATGGACGAGGCCATGT
CCGCCGACCCGGCCCTGCGGTCGACCATCATCGCCTGGGCCCAGTACGCGCCGCACGGCTTCCAGCGGCACGCGG
ATGCCTCTTCCGCCTTTCCCCACCGCGATGCCGTCGTCTTTGCGTGAGTCGCCCTCTTTCTCCCTCCCTCCAACA
GCACCCTGTCTTTTTTGATCCCACATCGCCACGTGTTCCGCCCCCCTCGGCGCAACCCGCCCCGTCCGCTCTCGG
GCGCAGATGGCTGACAAGGGGCCCGCACAGTCAGATCGACGGCTTCGCCGAGCAGGCGGCGCAGGTGCCCGCCCT
GGCGCGCTTCGGCCGGGACCTGCGCCGCAGGCTGCAACGGGCCAGCGGCCGGGACGCGCTCGCCGTCTACGCCCA
CTTCGCCCACGGCGACGAGGCGCCCGAGGCCTGGTACTCGGCTTCCCGCCTGGCGCGGCTGAGGGCCCTCAAGGC
CGTCTACGACCCGGAAAACCTCTTCTCCTACTACAACCCCGTCCTCGGGCGGTCGGGCTGCCGCGCGGGGGCTTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail