Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|559
Gene name
LocationContig_111:14577..16340
Strand+
Gene length (bp)1763
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07350 DUF1479 Protein of unknown function (DUF1479) 3.0E-158 55 477

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P75791|YBIU_ECOLI Uncharacterized protein YbiU OS=Escherichia coli (strain K12) GN=ybiU PE=1 SV=1 61 478 4.0E-48

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.1246 0.1565 0.0368 0.0306 0.8685 0.0692 0.0504 0.0427 0.0771 0.0244

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup368
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3480
Ophiocordyceps australis map64 (Brazil) OphauB2|6705
Ophiocordyceps camponoti-floridani Ophcf2|02181
Ophiocordyceps camponoti-rufipedis Ophun1|1479
Ophiocordyceps kimflemingae Ophio5|2863
Ophiocordyceps kimflemingae Ophio5|2864
Ophiocordyceps subramaniannii Hirsu2|10134
Ophiocordyceps subramaniannii Hirsu2|559 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|559
MMRPGLSMIRRSAQDQLRRRAASAVAAAVPSEQSSKKEGDISDAFVSLSGAGAGPLPDRYRQLKCDLVRGREQQI
VDSWTRLLRQLRQENELIGQKGSDLVPQVEFADLQRGCERLEGEIRKRGVLVVRGVIPEAEARAYKSEVEDYVEK
NPQTRAFPPHDPQVYELYWSGPQLKARSHPALLRVQQHLMSFLWHTSSAEAPISLANPLTYADRLRIRQPGDASF
ALGPHIDGGSVERWEKEGYGRGGVYDQILAGHWERHDPWDASGRVEAVNNRYDGLGAASMFRMWQGWVSMSSSGP
REGTLLVNPLMHLATAYVLLRPFFRPLARPAGSPGFLDEGNWALTAAADMTSDLQGASPGYGQEVSDELHPHLEL
DRTMVHVPRIKPGDFVAWHCDTIHAVDKLHTGRSDSSVLYIPVCPTTAINAEYVARQRTAFRDGTPGPDFPGGEG
ESRHVGRPTEAALRGWTTAAGRQAFGLEKLELRQDGLPGERAAVERANAILGF*
Coding >Hirsu2|559
ATGATGCGGCCCGGACTCAGCATGATACGGCGGAGCGCCCAGGACCAGCTCCGTCGCCGGGCGGCCTCGGCAGTG
GCAGCCGCCGTGCCGTCGGAACAGTCGAGCAAGAAGGAGGGCGACATCTCGGACGCGTTCGTGTCGCTGTCCGGG
GCCGGGGCGGGGCCGCTGCCGGACCGGTACCGGCAGCTCAAGTGCGACCTGGTGCGGGGGCGGGAGCAGCAGATC
GTCGACAGCTGGACCAGGCTCCTGCGGCAGCTGAGGCAGGAGAACGAGCTGATCGGCCAGAAGGGGTCCGACCTG
GTGCCGCAGGTGGAATTCGCCGACCTGCAGCGCGGCTGCGAGAGGCTGGAAGGCGAGATCAGGAAGAGGGGCGTG
CTGGTCGTGCGCGGCGTCATCCCCGAGGCCGAGGCCCGGGCGTATAAGAGCGAGGTCGAGGACTATGTCGAGAAG
AATCCACAGACCAGAGCCTTCCCGCCTCACGATCCGCAGGTGTACGAGCTGTACTGGTCCGGGCCGCAGCTCAAG
GCGCGGTCGCACCCGGCCCTGCTCCGCGTGCAGCAGCACCTCATGTCCTTCCTGTGGCACACGTCGTCGGCCGAG
GCGCCCATCTCGCTGGCCAACCCGCTCACGTACGCGGACCGGCTGCGGATCCGGCAGCCGGGCGACGCCTCCTTC
GCCCTGGGCCCGCACATCGACGGCGGCAGCGTGGAGCGGTGGGAGAAGGAGGGCTACGGCCGCGGCGGCGTCTAC
GACCAGATCCTGGCCGGCCACTGGGAGCGGCACGACCCGTGGGACGCCAGCGGCCGCGTCGAGGCCGTCAACAAC
CGCTACGACGGCCTGGGCGCCGCCTCCATGTTCCGCATGTGGCAGGGCTGGGTCAGCATGAGCTCGTCCGGCCCG
CGCGAGGGCACCCTGCTCGTCAACCCGCTCATGCACCTGGCCACGGCCTACGTCCTGCTCCGGCCCTTCTTCCGG
CCCCTGGCCCGCCCGGCCGGGAGCCCGGGCTTCCTGGACGAGGGCAACTGGGCCCTGACGGCCGCCGCCGACATG
ACGAGCGACCTCCAGGGGGCGTCGCCCGGCTACGGCCAGGAGGTTAGCGACGAGCTGCATCCGCATCTCGAGCTG
GACCGGACCATGGTCCACGTGCCCAGGATCAAGCCCGGCGACTTCGTTGCTTGGCATTGCGACACGATCCATGCG
GTCGACAAGCTCCACACCGGCCGGTCCGACTCGAGCGTGCTCTACATCCCGGTCTGCCCGACGACGGCCATCAAT
GCCGAGTACGTGGCCCGGCAGCGCACGGCGTTCCGGGACGGGACGCCGGGCCCCGACTTCCCCGGCGGCGAGGGC
GAGTCCCGGCACGTCGGCCGACCGACCGAGGCGGCGCTCCGCGGCTGGACGACGGCCGCCGGCAGGCAGGCCTTT
GGGCTGGAGAAGCTGGAGCTCAGGCAGGATGGGCTGCCGGGGGAGCGGGCGGCGGTCGAGAGGGCCAATGCCATC
CTCGGCTTCTAG
Transcript >Hirsu2|559
ATGATGCGGCCCGGACTCAGCATGATACGGCGGAGCGCCCAGGACCAGCTCCGTCGCCGGGCGGCCTCGGCAGTG
GCAGCCGCCGTGCCGTCGGAACAGTCGAGCAAGAAGGAGGGCGACATCTCGGACGCGTTCGTGTCGCTGTCCGGG
GCCGGGGCGGGGCCGCTGCCGGACCGGTACCGGCAGCTCAAGTGCGACCTGGTGCGGGGGCGGGAGCAGCAGATC
GTCGACAGCTGGACCAGGCTCCTGCGGCAGCTGAGGCAGGAGAACGAGCTGATCGGCCAGAAGGGGTCCGACCTG
GTGCCGCAGGTGGAATTCGCCGACCTGCAGCGCGGCTGCGAGAGGCTGGAAGGCGAGATCAGGAAGAGGGGCGTG
CTGGTCGTGCGCGGCGTCATCCCCGAGGCCGAGGCCCGGGCGTATAAGAGCGAGGTCGAGGACTATGTCGAGAAG
AATCCACAGACCAGAGCCTTCCCGCCTCACGATCCGCAGGTGTACGAGCTGTACTGGTCCGGGCCGCAGCTCAAG
GCGCGGTCGCACCCGGCCCTGCTCCGCGTGCAGCAGCACCTCATGTCCTTCCTGTGGCACACGTCGTCGGCCGAG
GCGCCCATCTCGCTGGCCAACCCGCTCACGTACGCGGACCGGCTGCGGATCCGGCAGCCGGGCGACGCCTCCTTC
GCCCTGGGCCCGCACATCGACGGCGGCAGCGTGGAGCGGTGGGAGAAGGAGGGCTACGGCCGCGGCGGCGTCTAC
GACCAGATCCTGGCCGGCCACTGGGAGCGGCACGACCCGTGGGACGCCAGCGGCCGCGTCGAGGCCGTCAACAAC
CGCTACGACGGCCTGGGCGCCGCCTCCATGTTCCGCATGTGGCAGGGCTGGGTCAGCATGAGCTCGTCCGGCCCG
CGCGAGGGCACCCTGCTCGTCAACCCGCTCATGCACCTGGCCACGGCCTACGTCCTGCTCCGGCCCTTCTTCCGG
CCCCTGGCCCGCCCGGCCGGGAGCCCGGGCTTCCTGGACGAGGGCAACTGGGCCCTGACGGCCGCCGCCGACATG
ACGAGCGACCTCCAGGGGGCGTCGCCCGGCTACGGCCAGGAGGTTAGCGACGAGCTGCATCCGCATCTCGAGCTG
GACCGGACCATGGTCCACGTGCCCAGGATCAAGCCCGGCGACTTCGTTGCTTGGCATTGCGACACGATCCATGCG
GTCGACAAGCTCCACACCGGCCGGTCCGACTCGAGCGTGCTCTACATCCCGGTCTGCCCGACGACGGCCATCAAT
GCCGAGTACGTGGCCCGGCAGCGCACGGCGTTCCGGGACGGGACGCCGGGCCCCGACTTCCCCGGCGGCGAGGGC
GAGTCCCGGCACGTCGGCCGACCGACCGAGGCGGCGCTCCGCGGCTGGACGACGGCCGCCGGCAGGCAGGCCTTT
GGGCTGGAGAAGCTGGAGCTCAGGCAGGATGGGCTGCCGGGGGAGCGGGCGGCGGTCGAGAGGGCCAATGCCATC
CTCGGCTTCTAG
Gene >Hirsu2|559
ATGATGCGGCCCGGACTCAGCATGATACGGCGGAGCGCCCAGGACCAGCTCCGTCGCCGGGCGGCCTCGGCAGTG
GCAGCCGCCGTGCCGTCGGAACAGTCGAGCAAGAAGGAGGGCGACATCTCGGACGCGTTCGTGTCGCTGTCCGGG
GCCGGGGCGGGGCCGCTGCCGGACCGGTACCGGCAGCTCAAGTGCGACCTGGTGCGGGGGCGGGAGCAGCAGATC
GTCGACAGCTGGACCAGGCTCCTGCGGCAGCTGAGGCAGGAGAACGAGCTGATCGGCCAGAAGGGGTCCGACCTG
GTGCCGCAGGTGGAATTCGCCGACCTGCAGCGCGGCTGCGAGAGGCTGGAAGGCGAGATCAGGAAGAGGGGCGTG
CTGGTCGTGCGCGGCGTCATCCCCGAGGCCGAGGCCCGGGCGTATAAGAGCGAGGTCGAGGACTATGTCGAGAAG
AATCCACAGACCAGAGGTAAGGCTGCCCTCGAGGAGATGAGCAAGAAGCAGGCAGCTTCGAGGGCCACGAGTCTA
CATCCATGCACGTGTAGGCAGCAGGCGTTCTCGAGACTGACGATGCGCGACGGGCAGCCTTCCCGCCTCACGATC
CGCAGGTGTACGAGCTGTACTGGTCCGGGCCGCAGCTCAAGGCGCGGTCGCACCCGGCCCTGCTCCGCGTGCAGC
AGCACCTCATGTCCTTCCTGTGGCACACGTCGTCGGCCGAGGCGCCCATCTCGCTGGCCAACCCGCTCACGTACG
CGGACCGGCTGCGGATCCGGCAGCCGGGCGACGCCTCCTTCGCCCTGGGCCCGCACATCGACGGCGGCAGCGTGG
AGCGGTGGGAGAAGGAGGGCTACGGCCGCGGCGGCGTCTACGACCAGATCCTGGCCGGCCACTGGGAGCGGCACG
ACCCGTGGGACGCCAGCGGCCGCGTCGAGGCCGTCAACAACCGCTACGACGGCCTGGGCGCCGCCTCCATGTTCC
GCATGTGGCAGGGCTGGGTCAGCATGAGCTCGTCCGGCCCGCGCGAGGGCACCCTGCTCGTCAACCCGCTCATGC
ACCTGGCCACGGCCTACGTCCTGCTCCGGCCCTTCTTCCGGCCCCTGGCCCGCCCGGCCGGGAGCCCGGGCTTCC
TGGACGAGGGCAACTGGGCCCTGACGGCCGCCGCCGACATGACGAGCGACCTCCAGGGGGCGTCGCCCGGCTACG
GCCAGGAGGTTAGCGACGAGCTGCATCCGCATCTCGAGCTGGACCGGACCATGGTCCACGTGCCCAGGATCAAGC
CCGGCGACTTCGTTGCTTGGCATTGCGACAGTGAGTTCGCCGTCTTCCCCCCTTTCCCCTCTTCTTCCCTATCGG
CCGACGGCCCGACGTTGGGCAGGAAAAAAAAACAAAAACATGGGCTCGGGCCCGGCTGCAAGGATGAAGTTAACG
GACTCGGGCCGGCAGCGATCCATGCGGTCGACAAGCTCCACACCGGCCGGTCCGACTCGAGCGTGCTCTACATCC
CGGTCTGCCCGACGACGGCCATCAATGCCGAGTACGTGGCCCGGCAGCGCACGGCGTTCCGGGACGGGACGCCGG
GCCCCGACTTCCCCGGCGGCGAGGGCGAGTCCCGGCACGTCGGCCGACCGACCGAGGCGGCGCTCCGCGGCTGGA
CGACGGCCGCCGGCAGGCAGGCCTTTGGGCTGGAGAAGCTGGAGCTCAGGCAGGATGGGCTGCCGGGGGAGCGGG
CGGCGGTCGAGAGGGCCAATGCCATCCTCGGCTTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail