Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5585
Gene name
LocationContig_28:53498..55121
Strand+
Gene length (bp)1623
Transcript length (bp)1512
Coding sequence length (bp)1512
Protein length (aa) 504

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 5.9E-54 9 336
PF11954 DUF3471 Domain of unknown function (DUF3471) 3.2E-10 399 498

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06317|PBP4_AMYLA Penicillin-binding protein 4 OS=Amycolatopsis lactamdurans GN=pbp PE=3 SV=1 15 353 4.0E-16
sp|P32959|PBPE_BACSU Penicillin-binding protein 4* OS=Bacillus subtilis (strain 168) GN=pbpE PE=1 SV=1 16 316 9.0E-15
sp|P00811|AMPC_ECOLI Beta-lactamase OS=Escherichia coli (strain K12) GN=ampC PE=1 SV=1 13 256 6.0E-13
sp|P24735|AMPC_PSEAE Beta-lactamase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ampC PE=1 SV=2 11 258 3.0E-12
sp|A6WYS5|DAP_OCHA4 D-aminopeptidase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dap PE=3 SV=1 12 365 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06317|PBP4_AMYLA Penicillin-binding protein 4 OS=Amycolatopsis lactamdurans GN=pbp PE=3 SV=1 15 353 4.0E-16
sp|P32959|PBPE_BACSU Penicillin-binding protein 4* OS=Bacillus subtilis (strain 168) GN=pbpE PE=1 SV=1 16 316 9.0E-15
sp|P00811|AMPC_ECOLI Beta-lactamase OS=Escherichia coli (strain K12) GN=ampC PE=1 SV=1 13 256 6.0E-13
sp|P24735|AMPC_PSEAE Beta-lactamase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ampC PE=1 SV=2 11 258 3.0E-12
sp|A6WYS5|DAP_OCHA4 D-aminopeptidase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dap PE=3 SV=1 12 365 3.0E-12
sp|Q9ZBA9|DAP_OCHAN D-aminopeptidase OS=Ochrobactrum anthropi GN=dap PE=1 SV=3 1 364 3.0E-11
sp|O31773|PBPX_BACSU Putative penicillin-binding protein PbpX OS=Bacillus subtilis (strain 168) GN=pbpX PE=2 SV=1 4 255 6.0E-11
sp|P15555|DAC_STRSR D-alanyl-D-alanine carboxypeptidase OS=Streptomyces sp. (strain R61) PE=1 SV=2 23 197 3.0E-10
sp|A5VVL2|DAP_BRUO2 D-aminopeptidase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dap PE=3 SV=1 11 319 3.0E-10
sp|Q8YD27|DAP_BRUME D-aminopeptidase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dap PE=3 SV=1 11 319 8.0E-10
sp|C0RM93|DAP_BRUMB D-aminopeptidase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=dap PE=3 SV=1 11 319 9.0E-10
sp|P18539|AMPC_SERMA Beta-lactamase OS=Serratia marcescens GN=ampC PE=3 SV=1 5 257 9.0E-10
sp|B2SD81|DAP_BRUA1 D-aminopeptidase OS=Brucella abortus (strain S19) GN=dap PE=3 SV=1 11 319 9.0E-10
sp|Q2YLB4|DAP_BRUA2 D-aminopeptidase OS=Brucella abortus (strain 2308) GN=dap PE=3 SV=1 11 319 9.0E-10
sp|A9MCM7|DAP_BRUC2 D-aminopeptidase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dap PE=3 SV=1 11 319 9.0E-10
sp|A9WVV8|DAP_BRUSI D-aminopeptidase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dap PE=3 SV=1 11 319 9.0E-10
sp|Q8FV99|DAP_BRUSU D-aminopeptidase OS=Brucella suis biovar 1 (strain 1330) GN=dap PE=3 SV=1 11 319 9.0E-10
sp|Q579G4|DAP_BRUAB D-aminopeptidase OS=Brucella abortus biovar 1 (strain 9-941) GN=dap PE=3 SV=1 11 319 9.0E-10
sp|P05193|AMPC_CITFR Beta-lactamase OS=Citrobacter freundii GN=ampC PE=1 SV=1 13 253 7.0E-09
sp|P85302|AMPC_PSEFL Beta-lactamase OS=Pseudomonas fluorescens GN=ampC PE=1 SV=1 2 198 1.0E-08
sp|P94958|AMPC_MORMO Beta-lactamase OS=Morganella morganii GN=ampC PE=3 SV=1 13 198 4.0E-08
sp|P05364|AMPC_ENTCL Beta-lactamase OS=Enterobacter cloacae GN=ampC PE=1 SV=1 13 258 1.0E-07
sp|P45460|AMPC_YEREN Beta-lactamase OS=Yersinia enterocolitica GN=ampC PE=3 SV=1 16 299 3.0E-07
sp|Q48743|AMPC_LYSLA Beta-lactamase OS=Lysobacter lactamgenus PE=3 SV=1 7 219 7.0E-07
sp|O69773|AMPC_PROST Beta-lactamase OS=Providencia stuartii GN=ampC PE=3 SV=1 13 252 1.0E-06
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 17 335 2.0E-06
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 17 335 2.0E-06
sp|Q6GDZ1|FLP_STAAR Protein flp OS=Staphylococcus aureus (strain MRSA252) GN=flp PE=3 SV=1 17 335 2.0E-06
sp|Q5HDB2|FLP_STAAC Protein flp OS=Staphylococcus aureus (strain COL) GN=flp PE=4 SV=1 17 335 2.0E-06
sp|Q7A3Q5|FLP_STAAN Protein flp OS=Staphylococcus aureus (strain N315) GN=flp PE=1 SV=1 17 335 3.0E-06
sp|Q99RJ0|FLP_STAAM Protein flp OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=flp PE=3 SV=1 17 335 3.0E-06
sp|Q9KJ74|FLP_STAAU Protein flp OS=Staphylococcus aureus GN=flp PE=4 SV=1 17 335 8.0E-06
sp|Q2FVH6|FLP_STAA8 Protein flp OS=Staphylococcus aureus (strain NCTC 8325) GN=flp PE=4 SV=1 17 335 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5585
MDLLQSADFTAYVKKLIERHHVPGLAIAIVQDDKVSSAAYGKASLEPARDFTTDTLFCVGSAAKSLTAASVALLV
EDDKHPEVQFDAPVSKLLPGEFVLPGEDHDDVTVEDVLSHRTGMAPHEYAILGPRAKQPDDARSITMNLRNLSVI
APNREEFTYCNMMYTASTYLVERISGMPFSDFLRQRIFDPLGMNSSYLLLDSVKAKGQGDRVATGYSWEKGQHRE
IHCCDGPEAQGAGQIFSSIDDYARWVKAMIRHEGPITERISTALTTKRIQTDPEQDEKQESCTFYALGWQVHEYG
GHKMVSHDGGEPGYQCNHFFLPELNFGGAIFSNCDQADTLVSLLMYRLIDDVAHADQKSQHSDSVSESGSESESV
SDEDEDDDGLEEELRQELSPGIEQPQPQKIPLSAYTGRYWNKGYRGIEVEERDGVLHVDGTDRSYGFTLSFKHIC
EQTKYICYVTQTFESSDLPIKAEFRLEDNKAVKLGLHLEERIDDYIWFDKVDG*
Coding >Hirsu2|5585
ATGGATCTGCTTCAGTCCGCCGACTTCACCGCCTACGTGAAGAAGCTCATCGAGCGTCACCATGTGCCGGGGCTG
GCCATCGCCATCGTGCAGGACGACAAGGTCTCGTCGGCCGCCTATGGCAAGGCCTCGCTGGAGCCGGCCAGGGAC
TTCACCACCGACACGCTCTTCTGCGTCGGCTCGGCGGCCAAGTCGCTGACGGCGGCCTCGGTCGCCCTTCTGGTC
GAGGACGATAAGCACCCAGAGGTCCAGTTCGACGCCCCCGTGTCGAAACTGCTGCCCGGCGAGTTCGTCCTGCCC
GGCGAGGATCACGACGACGTGACGGTGGAGGACGTGCTGAGCCATCGGACTGGCATGGCGCCACATGAGTACGCC
ATCCTCGGCCCCCGGGCGAAGCAGCCGGACGATGCGCGGTCGATCACGATGAACCTGCGGAACCTGTCCGTCATC
GCGCCGAACCGCGAAGAGTTCACGTACTGTAATATGATGTATACCGCCTCCACCTATCTCGTGGAGCGGATAAGC
GGCATGCCCTTCTCCGACTTCCTCAGGCAGCGCATCTTCGACCCCCTCGGCATGAACTCGAGCTACCTCCTACTG
GACTCGGTCAAGGCCAAGGGGCAGGGTGACCGAGTCGCCACCGGCTACTCCTGGGAAAAGGGCCAGCACCGGGAA
ATCCACTGCTGCGACGGCCCGGAGGCGCAAGGCGCGGGCCAGATCTTCTCGAGCATCGACGACTACGCCCGATGG
GTCAAGGCCATGATCCGCCACGAGGGCCCGATCACGGAGCGCATCTCGACCGCGCTGACGACGAAGCGGATCCAG
ACGGACCCGGAGCAAGACGAGAAGCAGGAATCGTGCACGTTCTACGCCCTCGGCTGGCAAGTGCACGAGTACGGC
GGCCACAAGATGGTGTCGCACGACGGCGGCGAGCCCGGCTATCAGTGCAACCACTTCTTCCTGCCGGAGCTCAAC
TTCGGCGGCGCCATCTTTAGCAACTGCGACCAGGCCGACACGCTCGTCAGCCTGCTCATGTACCGCCTCATCGAC
GACGTGGCCCACGCGGACCAGAAGTCGCAGCACTCGGACAGCGTGTCGGAGTCGGGCTCCGAGTCCGAGTCCGTC
TCGGACGAGGACGAGGACGACGACGGACTCGAGGAGGAGCTCCGGCAGGAGCTGTCGCCCGGCATCGAGCAGCCG
CAGCCGCAGAAGATCCCGCTGAGCGCCTACACCGGCCGCTACTGGAACAAGGGCTACCGCGGCATCGAGGTCGAG
GAGCGGGACGGCGTCCTCCACGTCGACGGCACGGACCGCTCCTACGGCTTCACCCTCAGCTTCAAGCACATCTGT
GAGCAGACCAAGTACATCTGCTACGTCACCCAGACCTTCGAGAGCAGCGATCTCCCCATCAAGGCCGAGTTCCGG
CTTGAGGACAACAAGGCTGTCAAGCTGGGCCTGCATCTAGAGGAGCGGATCGACGACTATATCTGGTTCGATAAG
GTGGATGGGTGA
Transcript >Hirsu2|5585
ATGGATCTGCTTCAGTCCGCCGACTTCACCGCCTACGTGAAGAAGCTCATCGAGCGTCACCATGTGCCGGGGCTG
GCCATCGCCATCGTGCAGGACGACAAGGTCTCGTCGGCCGCCTATGGCAAGGCCTCGCTGGAGCCGGCCAGGGAC
TTCACCACCGACACGCTCTTCTGCGTCGGCTCGGCGGCCAAGTCGCTGACGGCGGCCTCGGTCGCCCTTCTGGTC
GAGGACGATAAGCACCCAGAGGTCCAGTTCGACGCCCCCGTGTCGAAACTGCTGCCCGGCGAGTTCGTCCTGCCC
GGCGAGGATCACGACGACGTGACGGTGGAGGACGTGCTGAGCCATCGGACTGGCATGGCGCCACATGAGTACGCC
ATCCTCGGCCCCCGGGCGAAGCAGCCGGACGATGCGCGGTCGATCACGATGAACCTGCGGAACCTGTCCGTCATC
GCGCCGAACCGCGAAGAGTTCACGTACTGTAATATGATGTATACCGCCTCCACCTATCTCGTGGAGCGGATAAGC
GGCATGCCCTTCTCCGACTTCCTCAGGCAGCGCATCTTCGACCCCCTCGGCATGAACTCGAGCTACCTCCTACTG
GACTCGGTCAAGGCCAAGGGGCAGGGTGACCGAGTCGCCACCGGCTACTCCTGGGAAAAGGGCCAGCACCGGGAA
ATCCACTGCTGCGACGGCCCGGAGGCGCAAGGCGCGGGCCAGATCTTCTCGAGCATCGACGACTACGCCCGATGG
GTCAAGGCCATGATCCGCCACGAGGGCCCGATCACGGAGCGCATCTCGACCGCGCTGACGACGAAGCGGATCCAG
ACGGACCCGGAGCAAGACGAGAAGCAGGAATCGTGCACGTTCTACGCCCTCGGCTGGCAAGTGCACGAGTACGGC
GGCCACAAGATGGTGTCGCACGACGGCGGCGAGCCCGGCTATCAGTGCAACCACTTCTTCCTGCCGGAGCTCAAC
TTCGGCGGCGCCATCTTTAGCAACTGCGACCAGGCCGACACGCTCGTCAGCCTGCTCATGTACCGCCTCATCGAC
GACGTGGCCCACGCGGACCAGAAGTCGCAGCACTCGGACAGCGTGTCGGAGTCGGGCTCCGAGTCCGAGTCCGTC
TCGGACGAGGACGAGGACGACGACGGACTCGAGGAGGAGCTCCGGCAGGAGCTGTCGCCCGGCATCGAGCAGCCG
CAGCCGCAGAAGATCCCGCTGAGCGCCTACACCGGCCGCTACTGGAACAAGGGCTACCGCGGCATCGAGGTCGAG
GAGCGGGACGGCGTCCTCCACGTCGACGGCACGGACCGCTCCTACGGCTTCACCCTCAGCTTCAAGCACATCTGT
GAGCAGACCAAGTACATCTGCTACGTCACCCAGACCTTCGAGAGCAGCGATCTCCCCATCAAGGCCGAGTTCCGG
CTTGAGGACAACAAGGCTGTCAAGCTGGGCCTGCATCTAGAGGAGCGGATCGACGACTATATCTGGTTCGATAAG
GTGGATGGGTGA
Gene >Hirsu2|5585
ATGGATCTGCTTCAGTCCGCCGACTTCACCGCCTACGTGAAGAAGCTCATCGAGCGTCACCATGTGCCGGGGCTG
GCCATCGCCATCGTGCAGGACGACAAGGTCTCGTCGGCCGCCTATGGCAAGGCCTCGCTGGAGCCGGCCAGGGAC
TTCACCACCGACACGCTCTTCTGCGTCGGCTCGGCGGCCAAGTCGCTGACGGCGGCCTCGGTCGCCCTTCTGGTC
GAGGACGATAAGCACCCAGAGGTCCAGTTCGACGCCCCCGTGTCGAAACTGCTGCCCGGCGAGTTCGTCCTGCCC
GGCGAGGATCACGACGACGTGACGGTGGAGGACGTGCTGAGCCATCGGACTGGCATGGCGCCGTAAGTCCGCTCC
GTGTTGCCCCACACTCCGTCGGCCTCGGCCGGCTCCGGCCCGGAGCAAGGCCGGCCCCTTGACCACGGAGTGCTG
ACGAAGCTGTCACTCTCTGCCAGACATGAGTACGCCATCCTCGGCCCCCGGGCGAAGCAGCCGGACGATGCGCGG
TCGATCACGATGAACCTGCGGAACCTGTCCGTCATCGCGCCGAACCGCGAAGAGTTCACGTACTGTAATATGATG
TATACCGCCTCCACCTATCTCGTGGAGCGGATAAGCGGCATGCCCTTCTCCGACTTCCTCAGGCAGCGCATCTTC
GACCCCCTCGGCATGAACTCGAGCTACCTCCTACTGGACTCGGTCAAGGCCAAGGGGCAGGGTGACCGAGTCGCC
ACCGGCTACTCCTGGGAAAAGGGCCAGCACCGGGAAATCCACTGCTGCGACGGCCCGGAGGCGCAAGGCGCGGGC
CAGATCTTCTCGAGCATCGACGACTACGCCCGATGGGTCAAGGCCATGATCCGCCACGAGGGCCCGATCACGGAG
CGCATCTCGACCGCGCTGACGACGAAGCGGATCCAGACGGACCCGGAGCAAGACGAGAAGCAGGAATCGTGCACG
TTCTACGCCCTCGGCTGGCAAGTGCACGAGTACGGCGGCCACAAGATGGTGTCGCACGACGGCGGCGAGCCCGGC
TATCAGTGCAACCACTTCTTCCTGCCGGAGCTCAACTTCGGCGGCGCCATCTTTAGCAACTGCGACCAGGCCGAC
ACGCTCGTCAGCCTGCTCATGTACCGCCTCATCGACGACGTGGCCCACGCGGACCAGAAGTCGCAGCACTCGGAC
AGCGTGTCGGAGTCGGGCTCCGAGTCCGAGTCCGTCTCGGACGAGGACGAGGACGACGACGGACTCGAGGAGGAG
CTCCGGCAGGAGCTGTCGCCCGGCATCGAGCAGCCGCAGCCGCAGAAGATCCCGCTGAGCGCCTACACCGGCCGC
TACTGGAACAAGGGCTACCGCGGCATCGAGGTCGAGGAGCGGGACGGCGTCCTCCACGTCGACGGCACGGACCGC
TCCTACGGCTTCACCCTCAGCTTCAAGCACATCTGTGAGCAGACCAAGTACATCTGCTACGTCACCCAGACCTTC
GAGAGCAGCGATCTCCCCATCAAGGCCGAGTTCCGGCTTGAGGACAACAAGGCTGTCAAGCTGGGCCTGCATCTA
GAGGAGCGGATCGACGACTATATCTGGTTCGATAAGGTGGATGGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail