Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5584
Gene name
LocationContig_28:45063..46263
Strand-
Gene length (bp)1200
Transcript length (bp)1200
Coding sequence length (bp)1200
Protein length (aa) 400

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01728 FtsJ FtsJ-like methyltransferase 8.0E-13 116 314

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0032259 methylation Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5584
MEASPSKSASPWFSDKMSTEAEGANPGQIIKTYLRETEPEFRRLCEVREKVCLSLGGGAVWDLRQKAVGLMVSCL
QGWSNPEGDRFFERQRQRADQADDSTMLWFYSLMLKIGSEIQTNTRIFSIHQAEGDAGPPMILDLCMAPGGFLDN
ALSRNPESKAVAFSLPPEDGGHGVLLPDHLRDRAELRLLDVTMLAADMGVTQIPKDHPEAGDFLPRQLEPDRLFD
LVLADGQVLRTHRRAAYREPREARRLSCAQLAMGLEHVRPGGSMLMLLHRVEAWNTVCLLWALRQFSQVRLYKPR
AGHAKRSSFYLLATEIQSRSPAAARAVERWKGLWRMATFGSDDDFGAALRDGKPSPEEMLEEFGAELGRMGRRVW
RIQADALERAPFNRQSAGGGLGRR*
Coding >Hirsu2|5584
ATGGAGGCATCGCCCTCGAAATCGGCAAGTCCGTGGTTCAGCGATAAGATGTCGACCGAGGCAGAGGGCGCCAAC
CCCGGTCAAATTATCAAGACATATCTGCGCGAGACAGAGCCCGAGTTTCGGAGACTTTGTGAGGTCCGGGAGAAA
GTGTGTCTCAGCCTCGGCGGCGGCGCGGTTTGGGACCTGCGACAAAAAGCAGTTGGGCTAATGGTGAGCTGCCTA
CAGGGATGGAGCAACCCAGAAGGCGACAGGTTCTTCGAGAGGCAGAGGCAAAGGGCCGATCAGGCGGATGACAGC
ACCATGCTGTGGTTCTACTCGCTCATGCTCAAGATCGGCAGCGAGATTCAGACGAACACCCGGATCTTCTCGATA
CACCAAGCCGAGGGGGACGCAGGGCCGCCCATGATCTTGGACTTGTGCATGGCCCCGGGAGGGTTCCTGGACAAT
GCACTAAGCAGAAACCCGGAGTCGAAAGCCGTGGCCTTTAGCCTCCCGCCGGAGGATGGAGGACACGGTGTACTG
CTGCCGGACCACCTGCGGGACCGAGCCGAGTTGAGACTGCTGGACGTGACGATGCTCGCCGCAGACATGGGCGTG
ACGCAGATCCCGAAAGACCACCCGGAGGCGGGCGACTTTCTGCCGCGGCAGCTCGAGCCGGACCGGCTGTTCGAC
CTGGTGCTGGCGGACGGGCAGGTGCTGCGAACGCACCGGCGCGCGGCGTATCGCGAGCCGCGCGAGGCCCGCAGG
CTGTCGTGCGCTCAGCTGGCCATGGGCCTCGAGCACGTGCGGCCCGGGGGCAGCATGCTGATGCTTCTGCACCGC
GTCGAGGCCTGGAACACCGTCTGCCTGCTCTGGGCCTTGCGGCAGTTCAGCCAGGTGAGGCTGTACAAGCCCAGG
GCCGGCCACGCCAAGCGGTCCTCGTTCTACCTGCTGGCGACCGAGATCCAGAGCCGGAGCCCGGCGGCGGCGCGG
GCCGTGGAGCGGTGGAAGGGGCTGTGGCGCATGGCGACGTTCGGCTCCGACGACGACTTCGGCGCCGCGCTGCGC
GACGGGAAGCCCAGCCCGGAGGAGATGCTGGAAGAGTTCGGGGCCGAGCTCGGACGGATGGGACGGCGCGTGTGG
CGGATCCAGGCGGACGCGCTGGAGCGGGCGCCCTTCAACAGGCAGTCGGCCGGAGGAGGCCTCGGGAGACGATAA
Transcript >Hirsu2|5584
ATGGAGGCATCGCCCTCGAAATCGGCAAGTCCGTGGTTCAGCGATAAGATGTCGACCGAGGCAGAGGGCGCCAAC
CCCGGTCAAATTATCAAGACATATCTGCGCGAGACAGAGCCCGAGTTTCGGAGACTTTGTGAGGTCCGGGAGAAA
GTGTGTCTCAGCCTCGGCGGCGGCGCGGTTTGGGACCTGCGACAAAAAGCAGTTGGGCTAATGGTGAGCTGCCTA
CAGGGATGGAGCAACCCAGAAGGCGACAGGTTCTTCGAGAGGCAGAGGCAAAGGGCCGATCAGGCGGATGACAGC
ACCATGCTGTGGTTCTACTCGCTCATGCTCAAGATCGGCAGCGAGATTCAGACGAACACCCGGATCTTCTCGATA
CACCAAGCCGAGGGGGACGCAGGGCCGCCCATGATCTTGGACTTGTGCATGGCCCCGGGAGGGTTCCTGGACAAT
GCACTAAGCAGAAACCCGGAGTCGAAAGCCGTGGCCTTTAGCCTCCCGCCGGAGGATGGAGGACACGGTGTACTG
CTGCCGGACCACCTGCGGGACCGAGCCGAGTTGAGACTGCTGGACGTGACGATGCTCGCCGCAGACATGGGCGTG
ACGCAGATCCCGAAAGACCACCCGGAGGCGGGCGACTTTCTGCCGCGGCAGCTCGAGCCGGACCGGCTGTTCGAC
CTGGTGCTGGCGGACGGGCAGGTGCTGCGAACGCACCGGCGCGCGGCGTATCGCGAGCCGCGCGAGGCCCGCAGG
CTGTCGTGCGCTCAGCTGGCCATGGGCCTCGAGCACGTGCGGCCCGGGGGCAGCATGCTGATGCTTCTGCACCGC
GTCGAGGCCTGGAACACCGTCTGCCTGCTCTGGGCCTTGCGGCAGTTCAGCCAGGTGAGGCTGTACAAGCCCAGG
GCCGGCCACGCCAAGCGGTCCTCGTTCTACCTGCTGGCGACCGAGATCCAGAGCCGGAGCCCGGCGGCGGCGCGG
GCCGTGGAGCGGTGGAAGGGGCTGTGGCGCATGGCGACGTTCGGCTCCGACGACGACTTCGGCGCCGCGCTGCGC
GACGGGAAGCCCAGCCCGGAGGAGATGCTGGAAGAGTTCGGGGCCGAGCTCGGACGGATGGGACGGCGCGTGTGG
CGGATCCAGGCGGACGCGCTGGAGCGGGCGCCCTTCAACAGGCAGTCGGCCGGAGGAGGCCTCGGGAGACGATAA
Gene >Hirsu2|5584
ATGGAGGCATCGCCCTCGAAATCGGCAAGTCCGTGGTTCAGCGATAAGATGTCGACCGAGGCAGAGGGCGCCAAC
CCCGGTCAAATTATCAAGACATATCTGCGCGAGACAGAGCCCGAGTTTCGGAGACTTTGTGAGGTCCGGGAGAAA
GTGTGTCTCAGCCTCGGCGGCGGCGCGGTTTGGGACCTGCGACAAAAAGCAGTTGGGCTAATGGTGAGCTGCCTA
CAGGGATGGAGCAACCCAGAAGGCGACAGGTTCTTCGAGAGGCAGAGGCAAAGGGCCGATCAGGCGGATGACAGC
ACCATGCTGTGGTTCTACTCGCTCATGCTCAAGATCGGCAGCGAGATTCAGACGAACACCCGGATCTTCTCGATA
CACCAAGCCGAGGGGGACGCAGGGCCGCCCATGATCTTGGACTTGTGCATGGCCCCGGGAGGGTTCCTGGACAAT
GCACTAAGCAGAAACCCGGAGTCGAAAGCCGTGGCCTTTAGCCTCCCGCCGGAGGATGGAGGACACGGTGTACTG
CTGCCGGACCACCTGCGGGACCGAGCCGAGTTGAGACTGCTGGACGTGACGATGCTCGCCGCAGACATGGGCGTG
ACGCAGATCCCGAAAGACCACCCGGAGGCGGGCGACTTTCTGCCGCGGCAGCTCGAGCCGGACCGGCTGTTCGAC
CTGGTGCTGGCGGACGGGCAGGTGCTGCGAACGCACCGGCGCGCGGCGTATCGCGAGCCGCGCGAGGCCCGCAGG
CTGTCGTGCGCTCAGCTGGCCATGGGCCTCGAGCACGTGCGGCCCGGGGGCAGCATGCTGATGCTTCTGCACCGC
GTCGAGGCCTGGAACACCGTCTGCCTGCTCTGGGCCTTGCGGCAGTTCAGCCAGGTGAGGCTGTACAAGCCCAGG
GCCGGCCACGCCAAGCGGTCCTCGTTCTACCTGCTGGCGACCGAGATCCAGAGCCGGAGCCCGGCGGCGGCGCGG
GCCGTGGAGCGGTGGAAGGGGCTGTGGCGCATGGCGACGTTCGGCTCCGACGACGACTTCGGCGCCGCGCTGCGC
GACGGGAAGCCCAGCCCGGAGGAGATGCTGGAAGAGTTCGGGGCCGAGCTCGGACGGATGGGACGGCGCGTGTGG
CGGATCCAGGCGGACGCGCTGGAGCGGGCGCCCTTCAACAGGCAGTCGGCCGGAGGAGGCCTCGGGAGACGATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail