Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5577
Gene name
LocationContig_28:20476..25724
Strand-
Gene length (bp)5248
Transcript length (bp)5124
Coding sequence length (bp)5124
Protein length (aa) 1708

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.9E-21 129 418
PF00550 PP-binding Phosphopantetheine attachment site 1.5E-06 792 858
PF00132 Hexapep Bacterial transferase hexapeptide (six repeats) 1.2E-03 1297 1327

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 170 637 7.0E-22
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 274 637 5.0E-10
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 282 637 1.0E-08

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 936 958 22
2 1110 1132 22
3 1165 1187 22
4 1445 1467 22
5 1496 1518 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5577
MDWLSERSENIANRLSQLYSLPPAKVKQSAAFRALIGDSGVSKSVLLASIPVLPTRSYRPLHVFYLLITELPGPW
PPFALLFHFTRLQQVLPESPQASHQDDSTWLVQSTEGVIKESYGSISHFIARTEDPALSSAEYDNVMTYRQLGDF
VDSFTLPLGNGGSRQSKTVVAIVLPNGPLLAAVCLAVATYHVAVPLDPDEQLDQLQADLERVRACCIITTPGLAR
GRPDWFQHWLERKKIQVFRAEARRRGTVTVSDDRGRDLLAGRPEPARQNRADDVALLLFTKGIWGSRGLVSLTTH
SLVREAFQVTEAWRLEPQDSCISMAPIFEIGGITRGIMATIVSGGTIACTPSTSAHAFWEALDTTEPTWYLASLG
THKQILAEAPFHAETVERHTLRLACRSDGFIPTDLVCLIEDTFHCEVATTLEASESEPPSAHPSSAPSPARTVRF
SSASTAPATPRERRPRISLVTEFSERKASRESTTRWSTSRSASPRGILGRPSGDRLEVLPTMYSGLNYLDDDGYL
RIMGTSKEFIHRDGAEISPFQIEEAIEAAARTSDSPIHGRIADVLAFPTAHERLGEVVGLVLVPSPEALRVDLRT
LHDALRASPLDETKWPTLIVYMDELPQRRGKPLRARLRDRLSLPSLSDDTPYTAKHWEAKCPPPDTSFMEPIEVA
QCTVDLEAITAIIRSVVPGHFGVHVEENAQDGGYDVFLAPTAPGVPGLSSDWVEHIRRLMHVTLSMEGHMGFPGN
LHILSDPLPVGDDGGLDKAKLSEIQAELRKESLPNPIRHIDDRVKQAFAEALSCSVDAVDTKTSFFDLGGTTVRA
ERLVASLRIEFNIHMPFSLLARENTVEGISAYIEAVIRDEELVGGDHGCAETYSSTRIGLMLLQLLPLVVLYPAR
RSLQLTLQLWILSKTRFWQDTSSLVGRLANLSLSLIASWASVQLLFPFLGMAAKWLIIGRYKEGTYPMWGAYHTR
WWMVQKIVMLCGMGFFDINDHGKNLYCRMMGAKIGRNVSMADVSLGEWDLLDIRDGASLTKCQCRPFAAEENTSM
YLGRIIVGERASIGLLSVIAPGTEVLPDTRMGANSSSWEQRDAQTLKLVQPVPRIRDPHWILSLALTLPIYLIGW
FTSMLPWLCAVVAMLYMKPKNSTIPVRVILDWYQGSPLVAFNYLSVGSKVVFGPALFFVFAITVRYATRLVAGDL
PNDPADIRGNFASWRATLMRTLFPAAQLTELSELLGHHNEARSGALRLLGAKIGKRVCWPNQGPSIKDYHLVDIG
DDVTFGENSYLWTTDEDASGTITIGNGAVIADHVCVLPGVTIGERTTLGFGTLTRRGKFYDDDRTFIGCKDGDVA
HSDSFAEKLWAIADDEIESGSRPHSSPASSGGRSLRPKDSGETLVGSLSPLPVEEGRAASRAASKEQRDLRPSHD
LSSPENSPYNRAVYQRDAPYHVFSPFATLSFSFLMTLFTAFYWNVPALSSMKVAARFFVQYMEGVDSTYDILIVY
ALNFAASALLTSAFAVLALTFVVTAKRLLIGRYRPGVYDWDKSPYCQRWQLLVSVEKLIRRCYVDKGILSLLTGT
HWLVMYYRALGVKIGKDCSLFANGYPSLMITEADLIEIGDRVVIDDVGIISHIDRRGSIRLDHIKIGNRCVLRSG
SNILCGAEMKDESCLLEHTLVLPGEVVHEKWTMQRRPAERFYGSRKGSIPKSMTESA*
Coding >Hirsu2|5577
ATGGACTGGCTTTCGGAGCGATCCGAGAACATCGCCAACCGCTTATCGCAGCTCTACAGTCTGCCACCGGCCAAG
GTCAAGCAGAGCGCCGCCTTCCGCGCTCTGATCGGCGACTCGGGTGTCAGCAAGTCGGTGCTGCTGGCTTCAATC
CCCGTGCTGCCGACGCGCTCGTACCGGCCGCTACACGTTTTCTATCTCCTGATCACCGAACTGCCCGGGCCGTGG
CCCCCCTTCGCCCTACTTTTCCATTTCACCCGACTGCAGCAGGTGCTGCCAGAGAGCCCCCAGGCCAGCCACCAG
GATGACTCGACCTGGCTGGTGCAGAGCACCGAGGGCGTCATCAAGGAGTCTTACGGGTCCATTTCCCACTTCATC
GCTCGGACCGAGGACCCGGCCCTGTCGTCGGCCGAGTACGACAATGTCATGACGTACCGCCAGCTCGGCGACTTC
GTCGACAGCTTCACGCTACCGCTCGGCAACGGGGGTTCGCGGCAGTCCAAGACGGTCGTGGCCATCGTCCTGCCC
AACGGGCCGCTGCTCGCGGCCGTCTGTCTGGCCGTGGCAACCTACCACGTCGCCGTGCCGCTCGACCCGGACGAG
CAGCTCGACCAACTGCAGGCGGATCTGGAGCGCGTGCGCGCCTGCTGCATCATAACGACACCCGGGCTGGCACGC
GGACGGCCAGACTGGTTTCAGCACTGGCTGGAGCGCAAGAAGATCCAGGTGTTCCGGGCGGAGGCGCGCCGGCGC
GGCACCGTAACTGTCAGCGACGACCGCGGGCGTGACCTGCTGGCCGGGCGGCCGGAGCCGGCACGACAGAACCGG
GCCGACGACGTCGCCCTTCTACTATTCACTAAGGGCATCTGGGGCTCCCGCGGGCTCGTCTCATTGACGACGCAC
AGCCTCGTTCGCGAGGCCTTTCAGGTGACCGAGGCCTGGCGACTTGAGCCGCAGGACAGTTGTATCAGCATGGCA
CCCATTTTCGAAATTGGCGGCATTACCCGCGGTATCATGGCCACCATCGTGTCGGGTGGCACCATCGCATGCACC
CCGAGTACCAGCGCCCACGCCTTCTGGGAAGCCCTCGACACGACCGAACCGACGTGGTACCTCGCCTCGCTGGGC
ACGCACAAGCAAATCCTGGCCGAGGCGCCCTTTCATGCGGAGACGGTGGAGAGGCACACACTGCGGTTGGCCTGC
CGCTCCGACGGCTTCATCCCGACTGATCTGGTATGTTTGATAGAGGACACCTTTCATTGCGAGGTCGCCACCACG
CTCGAGGCCTCAGAAAGCGAGCCACCGTCGGCTCACCCGTCCAGCGCCCCCTCGCCGGCCCGCACCGTACGCTTC
TCCTCGGCGTCGACGGCTCCAGCCACGCCCCGGGAGCGGCGTCCGCGGATCTCGCTGGTGACGGAGTTCAGCGAG
CGCAAGGCGTCACGCGAGTCCACCACGCGCTGGTCCACTTCCCGGTCGGCGTCTCCCCGGGGCATCCTAGGGCGG
CCCTCCGGCGACCGGCTGGAGGTGCTCCCGACCATGTATAGCGGCCTCAACTACCTAGACGACGACGGCTATCTG
CGCATCATGGGCACCAGCAAGGAGTTCATCCACCGCGACGGGGCCGAGATCTCGCCCTTCCAGATCGAGGAGGCT
ATCGAGGCGGCGGCCAGGACAAGCGACTCGCCCATCCACGGCCGCATCGCCGACGTTCTGGCCTTCCCGACGGCG
CATGAGCGATTGGGCGAGGTCGTCGGTCTCGTGCTGGTGCCGAGCCCCGAGGCGCTCCGGGTCGACCTCCGGACG
CTGCACGATGCGCTGCGGGCCTCGCCCCTGGACGAGACCAAGTGGCCGACTCTGATCGTCTACATGGACGAGCTC
CCGCAGCGTCGGGGCAAGCCGCTCCGGGCCCGGCTCCGCGACCGACTTAGTCTGCCATCGCTGTCGGACGACACA
CCGTACACGGCCAAACACTGGGAGGCCAAGTGCCCGCCGCCTGATACCTCTTTCATGGAGCCAATCGAGGTGGCG
CAGTGCACGGTCGACCTGGAGGCCATCACGGCCATTATCCGGTCCGTCGTGCCCGGCCACTTCGGCGTGCACGTG
GAAGAGAACGCGCAGGACGGTGGTTACGATGTCTTCCTGGCCCCGACAGCGCCCGGCGTCCCCGGCCTCTCGTCC
GACTGGGTCGAGCACATCCGCCGCCTGATGCACGTCACCCTGTCGATGGAGGGCCACATGGGCTTCCCAGGCAAC
CTTCACATCCTGTCTGACCCGCTGCCGGTCGGTGACGACGGCGGCCTGGACAAGGCGAAGCTGTCGGAAATCCAG
GCCGAGCTCCGGAAGGAGTCTCTGCCGAACCCTATCCGGCACATCGACGACCGCGTCAAGCAGGCCTTCGCCGAG
GCCCTCTCATGCTCTGTCGACGCCGTTGACACCAAGACGAGCTTCTTCGATCTCGGCGGTACCACAGTCCGGGCG
GAGCGGCTGGTGGCCTCGCTGCGGATCGAGTTCAACATCCATATGCCCTTCAGCCTCCTGGCGCGCGAGAACACG
GTGGAGGGTATCTCGGCCTACATCGAGGCAGTCATCCGCGACGAAGAGCTCGTGGGCGGCGATCACGGCTGCGCC
GAGACGTACAGCTCGACTCGGATTGGTCTGATGCTGCTGCAGCTGTTGCCATTAGTCGTCCTTTATCCTGCGCGC
CGGTCGCTGCAGTTGACGCTTCAGCTCTGGATTCTCAGCAAGACGCGCTTCTGGCAGGACACATCGTCGCTTGTT
GGCAGACTGGCCAACCTCAGTCTCTCCCTCATCGCCTCCTGGGCTTCCGTCCAGCTCCTCTTCCCCTTCCTCGGA
ATGGCGGCCAAATGGCTTATTATCGGCCGCTATAAGGAGGGCACGTATCCAATGTGGGGGGCCTACCATACGCGC
TGGTGGATGGTGCAGAAAATCGTGATGCTATGCGGCATGGGCTTCTTCGACATCAACGACCACGGCAAGAATTTA
TACTGCCGAATGATGGGCGCCAAGATAGGACGCAACGTCAGCATGGCGGACGTCTCGCTTGGCGAGTGGGATTTA
CTGGACATCCGCGACGGAGCCAGCTTGACCAAGTGTCAGTGCCGGCCGTTTGCTGCCGAGGAGAACACGTCCATG
TATCTCGGCCGCATCATTGTCGGCGAGCGGGCGTCCATCGGCCTGCTATCGGTCATCGCGCCCGGCACCGAGGTG
CTGCCGGACACGCGCATGGGGGCCAACTCGTCCAGCTGGGAGCAGCGCGACGCCCAGACGCTGAAGCTGGTTCAG
CCGGTGCCGCGAATCCGCGACCCGCACTGGATCTTGTCGCTGGCCTTGACGCTGCCCATCTACCTCATCGGCTGG
TTCACATCGATGCTGCCCTGGCTGTGCGCCGTCGTCGCCATGCTGTATATGAAGCCCAAGAACAGCACGATTCCG
GTCCGAGTTATCCTCGATTGGTACCAGGGTAGCCCGCTGGTGGCCTTTAACTATCTGTCCGTCGGTAGCAAGGTC
GTCTTCGGCCCGGCCTTGTTCTTCGTCTTCGCCATCACCGTGCGCTATGCCACGAGGCTCGTCGCCGGCGACTTG
CCCAACGACCCGGCCGACATCCGCGGCAACTTCGCCTCGTGGCGGGCGACGCTGATGCGCACGCTATTCCCGGCC
GCGCAGCTGACCGAGCTCAGTGAGCTGCTAGGGCACCACAACGAGGCCCGCTCGGGGGCTCTGCGTCTGCTGGGG
GCCAAGATCGGGAAGAGAGTCTGCTGGCCGAACCAGGGGCCGTCGATCAAGGACTACCACCTTGTCGACATCGGC
GACGACGTCACGTTTGGCGAGAACAGCTACCTGTGGACGACGGACGAGGATGCATCCGGCACCATCACCATCGGC
AACGGTGCTGTCATCGCCGACCACGTATGCGTCCTGCCCGGTGTCACCATCGGTGAGCGCACGACGCTGGGGTTC
GGAACCCTGACGCGCCGCGGCAAGTTCTACGACGACGACCGTACCTTCATTGGCTGCAAGGACGGCGACGTTGCC
CACTCGGACAGCTTCGCTGAGAAATTGTGGGCGATCGCGGACGACGAGATCGAGTCCGGGTCCCGGCCCCACTCG
AGTCCGGCCTCCTCCGGCGGCCGCTCCCTCCGACCCAAGGACAGCGGCGAGACCTTGGTCGGCTCCCTCTCGCCG
CTGCCGGTCGAGGAGGGCCGGGCCGCGTCCCGGGCCGCGTCCAAGGAGCAGCGCGACCTCCGGCCCAGCCACGAC
CTGTCGTCGCCTGAGAATTCGCCCTACAACCGCGCCGTCTACCAGCGTGACGCGCCCTACCACGTCTTCTCCCCC
TTTGCCACCCTCTCCTTCTCCTTCCTCATGACTCTCTTCACTGCCTTCTACTGGAACGTGCCGGCGCTGTCGTCC
ATGAAGGTCGCCGCCCGCTTCTTTGTCCAGTATATGGAGGGCGTCGACAGCACGTACGACATCCTGATTGTCTAC
GCCCTCAACTTCGCCGCCTCGGCCCTCCTGACGTCCGCCTTCGCCGTCCTGGCACTCACCTTCGTTGTCACCGCC
AAGCGCCTCCTGATCGGCCGCTACCGGCCAGGCGTCTACGACTGGGATAAGTCTCCATATTGCCAGCGCTGGCAG
CTGCTCGTCTCGGTCGAGAAGCTGATCCGCCGCTGCTACGTCGACAAGGGCATCCTCAGCCTGCTGACGGGAACC
CACTGGCTCGTCATGTACTACCGCGCCCTGGGCGTCAAGATCGGCAAGGACTGCTCGCTCTTCGCCAACGGCTAC
CCCAGCCTGATGATCACCGAGGCGGACCTGATCGAGATTGGCGATCGGGTCGTCATCGACGACGTGGGCATCATT
TCGCACATTGACCGCCGCGGCAGCATCCGCCTGGACCACATCAAGATCGGAAACCGATGCGTGCTCCGCTCCGGC
AGTAACATACTTTGCGGCGCCGAGATGAAGGATGAAAGTTGTCTTCTCGAACATACTCTTGTTTTGCCGGGCGAG
GTTGTCCACGAGAAGTGGACGATGCAGCGGCGCCCTGCAGAGCGCTTCTACGGCTCGCGCAAGGGCAGTATACCC
AAGTCTATGACTGAAAGTGCTTAG
Transcript >Hirsu2|5577
ATGGACTGGCTTTCGGAGCGATCCGAGAACATCGCCAACCGCTTATCGCAGCTCTACAGTCTGCCACCGGCCAAG
GTCAAGCAGAGCGCCGCCTTCCGCGCTCTGATCGGCGACTCGGGTGTCAGCAAGTCGGTGCTGCTGGCTTCAATC
CCCGTGCTGCCGACGCGCTCGTACCGGCCGCTACACGTTTTCTATCTCCTGATCACCGAACTGCCCGGGCCGTGG
CCCCCCTTCGCCCTACTTTTCCATTTCACCCGACTGCAGCAGGTGCTGCCAGAGAGCCCCCAGGCCAGCCACCAG
GATGACTCGACCTGGCTGGTGCAGAGCACCGAGGGCGTCATCAAGGAGTCTTACGGGTCCATTTCCCACTTCATC
GCTCGGACCGAGGACCCGGCCCTGTCGTCGGCCGAGTACGACAATGTCATGACGTACCGCCAGCTCGGCGACTTC
GTCGACAGCTTCACGCTACCGCTCGGCAACGGGGGTTCGCGGCAGTCCAAGACGGTCGTGGCCATCGTCCTGCCC
AACGGGCCGCTGCTCGCGGCCGTCTGTCTGGCCGTGGCAACCTACCACGTCGCCGTGCCGCTCGACCCGGACGAG
CAGCTCGACCAACTGCAGGCGGATCTGGAGCGCGTGCGCGCCTGCTGCATCATAACGACACCCGGGCTGGCACGC
GGACGGCCAGACTGGTTTCAGCACTGGCTGGAGCGCAAGAAGATCCAGGTGTTCCGGGCGGAGGCGCGCCGGCGC
GGCACCGTAACTGTCAGCGACGACCGCGGGCGTGACCTGCTGGCCGGGCGGCCGGAGCCGGCACGACAGAACCGG
GCCGACGACGTCGCCCTTCTACTATTCACTAAGGGCATCTGGGGCTCCCGCGGGCTCGTCTCATTGACGACGCAC
AGCCTCGTTCGCGAGGCCTTTCAGGTGACCGAGGCCTGGCGACTTGAGCCGCAGGACAGTTGTATCAGCATGGCA
CCCATTTTCGAAATTGGCGGCATTACCCGCGGTATCATGGCCACCATCGTGTCGGGTGGCACCATCGCATGCACC
CCGAGTACCAGCGCCCACGCCTTCTGGGAAGCCCTCGACACGACCGAACCGACGTGGTACCTCGCCTCGCTGGGC
ACGCACAAGCAAATCCTGGCCGAGGCGCCCTTTCATGCGGAGACGGTGGAGAGGCACACACTGCGGTTGGCCTGC
CGCTCCGACGGCTTCATCCCGACTGATCTGGTATGTTTGATAGAGGACACCTTTCATTGCGAGGTCGCCACCACG
CTCGAGGCCTCAGAAAGCGAGCCACCGTCGGCTCACCCGTCCAGCGCCCCCTCGCCGGCCCGCACCGTACGCTTC
TCCTCGGCGTCGACGGCTCCAGCCACGCCCCGGGAGCGGCGTCCGCGGATCTCGCTGGTGACGGAGTTCAGCGAG
CGCAAGGCGTCACGCGAGTCCACCACGCGCTGGTCCACTTCCCGGTCGGCGTCTCCCCGGGGCATCCTAGGGCGG
CCCTCCGGCGACCGGCTGGAGGTGCTCCCGACCATGTATAGCGGCCTCAACTACCTAGACGACGACGGCTATCTG
CGCATCATGGGCACCAGCAAGGAGTTCATCCACCGCGACGGGGCCGAGATCTCGCCCTTCCAGATCGAGGAGGCT
ATCGAGGCGGCGGCCAGGACAAGCGACTCGCCCATCCACGGCCGCATCGCCGACGTTCTGGCCTTCCCGACGGCG
CATGAGCGATTGGGCGAGGTCGTCGGTCTCGTGCTGGTGCCGAGCCCCGAGGCGCTCCGGGTCGACCTCCGGACG
CTGCACGATGCGCTGCGGGCCTCGCCCCTGGACGAGACCAAGTGGCCGACTCTGATCGTCTACATGGACGAGCTC
CCGCAGCGTCGGGGCAAGCCGCTCCGGGCCCGGCTCCGCGACCGACTTAGTCTGCCATCGCTGTCGGACGACACA
CCGTACACGGCCAAACACTGGGAGGCCAAGTGCCCGCCGCCTGATACCTCTTTCATGGAGCCAATCGAGGTGGCG
CAGTGCACGGTCGACCTGGAGGCCATCACGGCCATTATCCGGTCCGTCGTGCCCGGCCACTTCGGCGTGCACGTG
GAAGAGAACGCGCAGGACGGTGGTTACGATGTCTTCCTGGCCCCGACAGCGCCCGGCGTCCCCGGCCTCTCGTCC
GACTGGGTCGAGCACATCCGCCGCCTGATGCACGTCACCCTGTCGATGGAGGGCCACATGGGCTTCCCAGGCAAC
CTTCACATCCTGTCTGACCCGCTGCCGGTCGGTGACGACGGCGGCCTGGACAAGGCGAAGCTGTCGGAAATCCAG
GCCGAGCTCCGGAAGGAGTCTCTGCCGAACCCTATCCGGCACATCGACGACCGCGTCAAGCAGGCCTTCGCCGAG
GCCCTCTCATGCTCTGTCGACGCCGTTGACACCAAGACGAGCTTCTTCGATCTCGGCGGTACCACAGTCCGGGCG
GAGCGGCTGGTGGCCTCGCTGCGGATCGAGTTCAACATCCATATGCCCTTCAGCCTCCTGGCGCGCGAGAACACG
GTGGAGGGTATCTCGGCCTACATCGAGGCAGTCATCCGCGACGAAGAGCTCGTGGGCGGCGATCACGGCTGCGCC
GAGACGTACAGCTCGACTCGGATTGGTCTGATGCTGCTGCAGCTGTTGCCATTAGTCGTCCTTTATCCTGCGCGC
CGGTCGCTGCAGTTGACGCTTCAGCTCTGGATTCTCAGCAAGACGCGCTTCTGGCAGGACACATCGTCGCTTGTT
GGCAGACTGGCCAACCTCAGTCTCTCCCTCATCGCCTCCTGGGCTTCCGTCCAGCTCCTCTTCCCCTTCCTCGGA
ATGGCGGCCAAATGGCTTATTATCGGCCGCTATAAGGAGGGCACGTATCCAATGTGGGGGGCCTACCATACGCGC
TGGTGGATGGTGCAGAAAATCGTGATGCTATGCGGCATGGGCTTCTTCGACATCAACGACCACGGCAAGAATTTA
TACTGCCGAATGATGGGCGCCAAGATAGGACGCAACGTCAGCATGGCGGACGTCTCGCTTGGCGAGTGGGATTTA
CTGGACATCCGCGACGGAGCCAGCTTGACCAAGTGTCAGTGCCGGCCGTTTGCTGCCGAGGAGAACACGTCCATG
TATCTCGGCCGCATCATTGTCGGCGAGCGGGCGTCCATCGGCCTGCTATCGGTCATCGCGCCCGGCACCGAGGTG
CTGCCGGACACGCGCATGGGGGCCAACTCGTCCAGCTGGGAGCAGCGCGACGCCCAGACGCTGAAGCTGGTTCAG
CCGGTGCCGCGAATCCGCGACCCGCACTGGATCTTGTCGCTGGCCTTGACGCTGCCCATCTACCTCATCGGCTGG
TTCACATCGATGCTGCCCTGGCTGTGCGCCGTCGTCGCCATGCTGTATATGAAGCCCAAGAACAGCACGATTCCG
GTCCGAGTTATCCTCGATTGGTACCAGGGTAGCCCGCTGGTGGCCTTTAACTATCTGTCCGTCGGTAGCAAGGTC
GTCTTCGGCCCGGCCTTGTTCTTCGTCTTCGCCATCACCGTGCGCTATGCCACGAGGCTCGTCGCCGGCGACTTG
CCCAACGACCCGGCCGACATCCGCGGCAACTTCGCCTCGTGGCGGGCGACGCTGATGCGCACGCTATTCCCGGCC
GCGCAGCTGACCGAGCTCAGTGAGCTGCTAGGGCACCACAACGAGGCCCGCTCGGGGGCTCTGCGTCTGCTGGGG
GCCAAGATCGGGAAGAGAGTCTGCTGGCCGAACCAGGGGCCGTCGATCAAGGACTACCACCTTGTCGACATCGGC
GACGACGTCACGTTTGGCGAGAACAGCTACCTGTGGACGACGGACGAGGATGCATCCGGCACCATCACCATCGGC
AACGGTGCTGTCATCGCCGACCACGTATGCGTCCTGCCCGGTGTCACCATCGGTGAGCGCACGACGCTGGGGTTC
GGAACCCTGACGCGCCGCGGCAAGTTCTACGACGACGACCGTACCTTCATTGGCTGCAAGGACGGCGACGTTGCC
CACTCGGACAGCTTCGCTGAGAAATTGTGGGCGATCGCGGACGACGAGATCGAGTCCGGGTCCCGGCCCCACTCG
AGTCCGGCCTCCTCCGGCGGCCGCTCCCTCCGACCCAAGGACAGCGGCGAGACCTTGGTCGGCTCCCTCTCGCCG
CTGCCGGTCGAGGAGGGCCGGGCCGCGTCCCGGGCCGCGTCCAAGGAGCAGCGCGACCTCCGGCCCAGCCACGAC
CTGTCGTCGCCTGAGAATTCGCCCTACAACCGCGCCGTCTACCAGCGTGACGCGCCCTACCACGTCTTCTCCCCC
TTTGCCACCCTCTCCTTCTCCTTCCTCATGACTCTCTTCACTGCCTTCTACTGGAACGTGCCGGCGCTGTCGTCC
ATGAAGGTCGCCGCCCGCTTCTTTGTCCAGTATATGGAGGGCGTCGACAGCACGTACGACATCCTGATTGTCTAC
GCCCTCAACTTCGCCGCCTCGGCCCTCCTGACGTCCGCCTTCGCCGTCCTGGCACTCACCTTCGTTGTCACCGCC
AAGCGCCTCCTGATCGGCCGCTACCGGCCAGGCGTCTACGACTGGGATAAGTCTCCATATTGCCAGCGCTGGCAG
CTGCTCGTCTCGGTCGAGAAGCTGATCCGCCGCTGCTACGTCGACAAGGGCATCCTCAGCCTGCTGACGGGAACC
CACTGGCTCGTCATGTACTACCGCGCCCTGGGCGTCAAGATCGGCAAGGACTGCTCGCTCTTCGCCAACGGCTAC
CCCAGCCTGATGATCACCGAGGCGGACCTGATCGAGATTGGCGATCGGGTCGTCATCGACGACGTGGGCATCATT
TCGCACATTGACCGCCGCGGCAGCATCCGCCTGGACCACATCAAGATCGGAAACCGATGCGTGCTCCGCTCCGGC
AGTAACATACTTTGCGGCGCCGAGATGAAGGATGAAAGTTGTCTTCTCGAACATACTCTTGTTTTGCCGGGCGAG
GTTGTCCACGAGAAGTGGACGATGCAGCGGCGCCCTGCAGAGCGCTTCTACGGCTCGCGCAAGGGCAGTATACCC
AAGTCTATGACTGAAAGTGCTTAG
Gene >Hirsu2|5577
ATGGACTGGCTTTCGGAGCGATCCGAGAACATCGCCAACCGCTTATCGCAGCTCTACAGTCTGCCACCGGCCAAG
GTCAAGCAGAGCGCCGCCTTCCGCGCTCTGATCGGCGACTCGGGTGTCAGCAAGTCGGTGCTGCTGGCTTCAATC
CCCGTGCTGCCGACGCGCTCGTACCGGCCGCTACACGTTTTCTATCTCCTGATCACCGAACTGCCCGGGCCGTGG
CCCCCCTTCGCCCTACTTTTCCATTTCACCCGACTGCAGCAGGTGCTGCCAGAGAGCCCCCAGGCCAGCCACCAG
GATGACTCGACCTGGCTGGTGCAGAGCACCGAGGGCGTCATCAAGGAGTCTTACGGGTCCATTTCCCACTTCATC
GCTCGGACCGAGGACCCGGCCCTGTCGTCGGCCGAGTACGACAATGTCATGACGTACCGCCAGCTCGGCGACTTC
GTCGACAGCTTCACGCTACCGCTCGGCAACGGGGGTTCGCGGCAGTCCAAGACGGTCGTGGCCATCGTCCTGCCC
AACGGGCCGCTGCTCGCGGCCGTCTGTCTGGCCGTGGCAACCTACCACGTCGCCGTGCCGCTCGACCCGGACGAG
CAGCTCGACCAACTGCAGGCGGATCTGGAGCGCGTGCGCGCCTGCTGCATCATAACGACACCCGGGCTGGCACGC
GGACGGCCAGACTGGTTTCAGCACTGGCTGGAGCGCAAGAAGATCCAGGTGTTCCGGGCGGAGGCGCGCCGGCGC
GGCACCGTAACTGTCAGCGACGACCGCGGGCGTGACCTGCTGGCCGGGCGGCCGGAGCCGGCACGACAGAACCGG
GCCGACGACGTCGCCCTTCTACTATTCACTAAGGGCATCTGGGGCTCCCGCGGGCTCGTCTCATTGACGACGCAC
AGCCTCGTTCGCGAGGCCTTTCAGGTGACCGAGGCCTGGCGACTTGAGCCGCAGGACAGTTGTATCAGCATGGCA
CCCATTTTCGAAATGTGAGTCTCTCTCGGATTGTCTCTCCGTCAGCCAAAGCTGACCGATATTCTCTCCCCTCGC
AGTGGCGGCATTACCCGCGGTATCATGGCCACCATCGTGTCGGGTGGCACCATCGCATGCACCCCGAGTACCAGC
GCCCACGCCTTCTGGGAAGCCCTCGACACGACCGAACCGACGTGGTACCTCGCCTCGCTGGGCACGCACAAGCAA
ATCCTGGCCGAGGCGCCCTTTCATGCGGAGACGGTGGAGAGGCACACACTGCGGTTGGCCTGCCGCTCCGACGGC
TTCATCCCGACTGATCTGGTATGTTTGATAGAGGACACCTTTCATTGCGAGGTCGCCACCACGCTCGAGGCCTCA
GAGTGAGTCTCGCAGTCTCCCTCCCCCCGTTCTCCTCTCTGCCGGTGCTGACGGGCCCTGCAGAAGCGAGCCACC
GTCGGCTCACCCGTCCAGCGCCCCCTCGCCGGCCCGCACCGTACGCTTCTCCTCGGCGTCGACGGCTCCAGCCAC
GCCCCGGGAGCGGCGTCCGCGGATCTCGCTGGTGACGGAGTTCAGCGAGCGCAAGGCGTCACGCGAGTCCACCAC
GCGCTGGTCCACTTCCCGGTCGGCGTCTCCCCGGGGCATCCTAGGGCGGCCCTCCGGCGACCGGCTGGAGGTGCT
CCCGACCATGTATAGCGGCCTCAACTACCTAGACGACGACGGCTATCTGCGCATCATGGGCACCAGCAAGGAGTT
CATCCACCGCGACGGGGCCGAGATCTCGCCCTTCCAGATCGAGGAGGCTATCGAGGCGGCGGCCAGGACAAGCGA
CTCGCCCATCCACGGCCGCATCGCCGACGTTCTGGCCTTCCCGACGGCGCATGAGCGATTGGGCGAGGTCGTCGG
TCTCGTGCTGGTGCCGAGCCCCGAGGCGCTCCGGGTCGACCTCCGGACGCTGCACGATGCGCTGCGGGCCTCGCC
CCTGGACGAGACCAAGTGGCCGACTCTGATCGTCTACATGGACGAGCTCCCGCAGCGTCGGGGCAAGCCGCTCCG
GGCCCGGCTCCGCGACCGACTTAGTCTGCCATCGCTGTCGGACGACACACCGTACACGGCCAAACACTGGGAGGC
CAAGTGCCCGCCGCCTGATACCTCTTTCATGGAGCCAATCGAGGTGGCGCAGTGCACGGTCGACCTGGAGGCCAT
CACGGCCATTATCCGGTCCGTCGTGCCCGGCCACTTCGGCGTGCACGTGGAAGAGAACGCGCAGGACGGTGGTTA
CGATGTCTTCCTGGCCCCGACAGCGCCCGGCGTCCCCGGCCTCTCGTCCGACTGGGTCGAGCACATCCGCCGCCT
GATGCACGTCACCCTGTCGATGGAGGGCCACATGGGCTTCCCAGGCAACCTTCACATCCTGTCTGACCCGCTGCC
GGTCGGTGACGACGGCGGCCTGGACAAGGCGAAGCTGTCGGAAATCCAGGCCGAGCTCCGGAAGGAGTCTCTGCC
GAACCCTATCCGGCACATCGACGACCGCGTCAAGCAGGCCTTCGCCGAGGCCCTCTCATGCTCTGTCGACGCCGT
TGACACCAAGACGAGCTTCTTCGATCTCGGCGGTACCACAGTCCGGGCGGAGCGGCTGGTGGCCTCGCTGCGGAT
CGAGTTCAACATCCATATGCCCTTCAGCCTCCTGGCGCGCGAGAACACGGTGGAGGGTATCTCGGCCTACATCGA
GGCAGTCATCCGCGACGAAGAGCTCGTGGGCGGCGATCACGGCTGCGCCGAGACGTACAGCTCGACTCGGATTGG
TCTGATGCTGCTGCAGCTGTTGCCATTAGTCGTCCTTTATCCTGCGCGCCGGTCGCTGCAGTTGACGCTTCAGCT
CTGGATTCTCAGCAAGACGCGCTTCTGGCAGGACACATCGTCGCTTGTTGGCAGACTGGCCAACCTCAGTCTCTC
CCTCATCGCCTCCTGGGCTTCCGTCCAGCTCCTCTTCCCCTTCCTCGGAATGGCGGCCAAATGGCTTATTATCGG
CCGCTATAAGGAGGGCACGTATCCAATGTGGGGGGCCTACCATACGCGCTGGTGGATGGTGCAGAAAATCGTGAT
GCTATGCGGCATGGGCTTCTTCGACATCAACGACCACGGCAAGAATTTATACTGCCGAATGATGGGCGCCAAGAT
AGGACGCAACGTCAGCATGGCGGACGTCTCGCTTGGCGAGTGGGATTTACTGGACATCCGCGACGGAGCCAGCTT
GACCAAGTGTCAGTGCCGGCCGTTTGCTGCCGAGGAGAACACGTCCATGTATCTCGGCCGCATCATTGTCGGCGA
GCGGGCGTCCATCGGCCTGCTATCGGTCATCGCGCCCGGCACCGAGGTGCTGCCGGACACGCGCATGGGGGCCAA
CTCGTCCAGCTGGGAGCAGCGCGACGCCCAGACGCTGAAGCTGGTTCAGCCGGTGCCGCGAATCCGCGACCCGCA
CTGGATCTTGTCGCTGGCCTTGACGCTGCCCATCTACCTCATCGGCTGGTTCACATCGATGCTGCCCTGGCTGTG
CGCCGTCGTCGCCATGCTGTATATGAAGCCCAAGAACAGCACGATTCCGGTCCGAGTTATCCTCGATTGGTACCA
GGGTAGCCCGCTGGTGGCCTTTAACTATCTGTCCGTCGGTAGCAAGGTCGTCTTCGGCCCGGCCTTGTTCTTCGT
CTTCGCCATCACCGTGCGCTATGCCACGAGGCTCGTCGCCGGCGACTTGCCCAACGACCCGGCCGACATCCGCGG
CAACTTCGCCTCGTGGCGGGCGACGCTGATGCGCACGCTATTCCCGGCCGCGCAGCTGACCGAGCTCAGTGAGCT
GCTAGGGCACCACAACGAGGCCCGCTCGGGGGCTCTGCGTCTGCTGGGGGCCAAGATCGGGAAGAGAGTCTGCTG
GCCGAACCAGGGGCCGTCGATCAAGGACTACCACCTTGTCGACATCGGCGACGACGTCACGTTTGGCGAGAACAG
CTACCTGTGGACGACGGACGAGGATGCATCCGGCACCATCACCATCGGCAACGGTGCTGTCATCGCCGACCACGT
ATGCGTCCTGCCCGGTGTCACCATCGGTGAGCGCACGACGCTGGGGTTCGGAACCCTGACGCGCCGCGGCAAGTT
CTACGACGACGACCGTACCTTCATTGGCTGCAAGGACGGCGACGTTGCCCACTCGGACAGCTTCGCTGAGAAATT
GTGGGCGATCGCGGACGACGAGATCGAGTCCGGGTCCCGGCCCCACTCGAGTCCGGCCTCCTCCGGCGGCCGCTC
CCTCCGACCCAAGGACAGCGGCGAGACCTTGGTCGGCTCCCTCTCGCCGCTGCCGGTCGAGGAGGGCCGGGCCGC
GTCCCGGGCCGCGTCCAAGGAGCAGCGCGACCTCCGGCCCAGCCACGACCTGTCGTCGCCTGAGAATTCGCCCTA
CAACCGCGCCGTCTACCAGCGTGACGCGCCCTACCACGTCTTCTCCCCCTTTGCCACCCTCTCCTTCTCCTTCCT
CATGACTCTCTTCACTGCCTTCTACTGGAACGTGCCGGCGCTGTCGTCCATGAAGGTCGCCGCCCGCTTCTTTGT
CCAGTATATGGAGGGCGTCGACAGCACGTACGACATCCTGATTGTCTACGCCCTCAACTTCGCCGCCTCGGCCCT
CCTGACGTCCGCCTTCGCCGTCCTGGCACTCACCTTCGTTGTCACCGCCAAGCGCCTCCTGATCGGCCGCTACCG
GCCAGGCGTCTACGACTGGGATAAGTCTCCATATTGCCAGCGCTGGCAGCTGCTCGTCTCGGTCGAGAAGCTGAT
CCGCCGCTGCTACGTCGACAAGGGCATCCTCAGCCTGCTGACGGGAACCCACTGGCTCGTCATGTACTACCGCGC
CCTGGGCGTCAAGATCGGCAAGGACTGCTCGCTCTTCGCCAACGGCTACCCCAGCCTGATGATCACCGAGGCGGA
CCTGATCGAGATTGGCGATCGGGTCGTCATCGACGACGTGGGCATCATTTCGCACATTGACCGCCGCGGCAGCAT
CCGCCTGGACCACATCAAGATCGGAAACCGATGCGTGCTCCGCTCCGGCAGTAACATACTTTGCGGCGCCGAGAT
GAAGGATGAAAGTTGTCTTCTCGAACATACTCTTGTTTTGCCGGGCGAGGTTGTCCACGAGAAGTGGACGATGCA
GCGGCGCCCTGCAGAGCGCTTCTACGGCTCGCGCAAGGGCAGTATACCCAAGTCTATGACTGAAAGTGCTTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail