Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5575
Gene name
LocationContig_28:16331..16982
Strand+
Gene length (bp)651
Transcript length (bp)651
Coding sequence length (bp)651
Protein length (aa) 217

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.7E-28 45 174
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 2.1E-16 77 211

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 2 215 5.0E-58
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 2 216 4.0E-22
sp|P0DN30|RTAI1_ARTBC Probable zinc-binding oxidoreductase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02327-2 PE=3 SV=1 2 215 2.0E-17
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1 215 5.0E-17
sp|O31186|ADHA_RHIME Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 1 216 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 2 215 5.0E-58
sp|O35017|YOGA_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YogA OS=Bacillus subtilis (strain 168) GN=yogA PE=3 SV=1 2 216 4.0E-22
sp|P0DN30|RTAI1_ARTBC Probable zinc-binding oxidoreductase, mitochondrial OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02327-2 PE=3 SV=1 2 215 2.0E-17
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1 215 5.0E-17
sp|O31186|ADHA_RHIME Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 1 216 1.0E-16
sp|P42327|ADH2_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 1 216 4.0E-16
sp|Q07288|ADH1_KLUMA Alcohol dehydrogenase 1 OS=Kluyveromyces marxianus GN=ADH1 PE=3 SV=1 1 134 2.0E-15
sp|P49384|ADH3_KLULA Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH3 PE=3 SV=2 1 214 5.0E-15
sp|Q7A742|ADH_STAAN Alcohol dehydrogenase OS=Staphylococcus aureus (strain N315) GN=adh PE=1 SV=1 1 213 5.0E-14
sp|Q99W07|ADH_STAAM Alcohol dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adh PE=3 SV=1 1 213 5.0E-14
sp|Q8NXU1|ADH_STAAW Alcohol dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=adh PE=3 SV=1 1 213 6.0E-14
sp|Q6GBM4|ADH_STAAS Alcohol dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=adh PE=3 SV=1 1 213 6.0E-14
sp|Q6GJ63|ADH_STAAR Alcohol dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=adh PE=3 SV=1 1 213 6.0E-14
sp|Q5HI63|ADH_STAAC Alcohol dehydrogenase OS=Staphylococcus aureus (strain COL) GN=adh PE=3 SV=1 1 213 6.0E-14
sp|Q2YSX0|ADH_STAAB Alcohol dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=adh PE=3 SV=1 1 213 6.0E-14
sp|Q2G0G1|ADH_STAA8 Alcohol dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=adh PE=3 SV=1 1 213 6.0E-14
sp|Q2FJ31|ADH_STAA3 Alcohol dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=adh PE=3 SV=1 1 213 6.0E-14
sp|P12311|ADH1_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 1 215 1.0E-13
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1 205 2.0E-13
sp|P42328|ADH3_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 1 216 2.0E-13
sp|O35045|YJMD_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YjmD OS=Bacillus subtilis (strain 168) GN=yjmD PE=2 SV=1 31 202 3.0E-13
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1 205 8.0E-13
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1 200 2.0E-12
sp|P49385|ADH4_KLULA Alcohol dehydrogenase 4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH4 PE=3 SV=2 1 214 3.0E-12
sp|Q9P4C2|ADH2_KLUMA Alcohol dehydrogenase 2 OS=Kluyveromyces marxianus GN=ADH2 PE=3 SV=3 1 214 3.0E-12
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1 200 3.0E-12
sp|P20369|ADH1_KLULA Alcohol dehydrogenase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH1 PE=3 SV=1 1 134 5.0E-12
sp|P49383|ADH2_KLULA Alcohol dehydrogenase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH2 PE=3 SV=2 1 134 5.0E-12
sp|O13309|ADH2_PICST Alcohol dehydrogenase 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH2 PE=3 SV=1 1 214 6.0E-12
sp|O00097|ADH1_PICST Alcohol dehydrogenase 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH1 PE=3 SV=1 1 214 7.0E-12
sp|O94038|ADH2_CANAL Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 1 214 8.0E-12
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 9 215 9.0E-12
sp|Q0VC50|RT4I1_BOVIN Reticulon-4-interacting protein 1, mitochondrial OS=Bos taurus GN=RTN4IP1 PE=2 SV=1 2 215 1.0E-11
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 9 215 1.0E-11
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1 137 2.0E-11
sp|Q924D0|RT4I1_MOUSE Reticulon-4-interacting protein 1, mitochondrial OS=Mus musculus GN=Rtn4ip1 PE=1 SV=2 2 215 3.0E-11
sp|P50381|ADH_SULSR NAD-dependent alcohol dehydrogenase OS=Sulfolobus sp. (strain RC3) GN=adh PE=3 SV=1 5 210 3.0E-11
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1 202 4.0E-11
sp|Q96XE0|ADH_SULTO NAD-dependent alcohol dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=adh PE=1 SV=1 5 210 4.0E-11
sp|Q53865|CCR_STRCU Crotonyl-CoA reductase OS=Streptomyces collinus GN=ccr PE=1 SV=1 2 213 6.0E-11
sp|Q7T3C7|RT4I1_DANRE Reticulon-4-interacting protein 1 homolog, mitochondrial OS=Danio rerio GN=rtn4ip1 PE=2 SV=2 2 215 8.0E-11
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 9 216 3.0E-10
sp|Q8CQ56|ADH_STAES Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=adh PE=3 SV=1 1 134 3.0E-10
sp|Q5HRD6|ADH_STAEQ Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=adh PE=3 SV=1 1 134 3.0E-10
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1 213 4.0E-10
sp|P07246|ADH3_YEAST Alcohol dehydrogenase 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH3 PE=1 SV=2 7 214 4.0E-10
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1 215 6.0E-10
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1 215 6.0E-10
sp|Q67N85|TDH_SYMTH L-threonine 3-dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tdh PE=3 SV=1 38 213 8.0E-10
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 31 213 1.0E-09
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 9 215 2.0E-09
sp|Q9P6C8|ADH1_NEUCR Alcohol dehydrogenase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adh-1 PE=3 SV=1 1 214 2.0E-09
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1 216 2.0E-09
sp|A4FND4|TDH_SACEN L-threonine 3-dehydrogenase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tdh PE=3 SV=1 23 214 2.0E-09
sp|P39462|ADH_SULSO NAD-dependent alcohol dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=adh PE=1 SV=1 5 210 3.0E-09
sp|Q82LU9|CCRA2_STRAW Crotonyl-CoA reductase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ccrA2 PE=1 SV=1 2 213 4.0E-09
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1 216 4.0E-09
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1 216 4.0E-09
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 32 213 4.0E-09
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1 205 6.0E-09
sp|P38113|ADH5_YEAST Alcohol dehydrogenase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH5 PE=1 SV=1 1 187 6.0E-09
sp|Q6XQ67|ADH5_SACPS Alcohol dehydrogenase 5 OS=Saccharomyces pastorianus GN=ADH5 PE=3 SV=1 1 187 6.0E-09
sp|C1D195|TDH_DEIDV L-threonine 3-dehydrogenase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=tdh PE=3 SV=1 23 214 9.0E-09
sp|P20368|ADH1_ZYMMO Alcohol dehydrogenase 1 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=adhA PE=1 SV=2 1 215 1.0E-08
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1 215 1.0E-08
sp|P41747|ADH1_ASPFN Alcohol dehydrogenase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=adh1 PE=2 SV=2 1 215 1.0E-08
sp|Q0KDL6|ADH_CUPNH Alcohol dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=adh PE=1 SV=1 1 216 2.0E-08
sp|P43067|ADH1_CANAX Alcohol dehydrogenase 1 OS=Candida albicans GN=ADH1 PE=1 SV=1 1 214 2.0E-08
sp|A4YGN0|SUCD_METS5 Succinate-semialdehyde dehydrogenase (acetylating) OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1424 PE=1 SV=1 1 213 2.0E-08
sp|F2Z678|ADH2_YARLI Alcohol dehydrogenase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADH2 PE=1 SV=1 1 214 3.0E-08
sp|Q9SV68|QORH_ARATH Putative quinone-oxidoreductase homolog, chloroplastic OS=Arabidopsis thaliana GN=At4g13010 PE=2 SV=1 2 111 4.0E-08
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1 216 4.0E-08
sp|P00331|ADH2_YEAST Alcohol dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH2 PE=1 SV=3 1 198 5.0E-08
sp|O45687|ADH2_CAEEL Alcohol dehydrogenase 2 OS=Caenorhabditis elegans GN=sodh-2 PE=3 SV=1 3 198 6.0E-08
sp|P00330|ADH1_YEAST Alcohol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH1 PE=1 SV=5 1 214 8.0E-08
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1 216 8.0E-08
sp|Q8U259|TDH_PYRFU Probable L-threonine 3-dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tdh PE=3 SV=1 2 216 8.0E-08
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 31 215 9.0E-08
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1 141 1.0E-07
sp|P00332|ADH_SCHPO Alcohol dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=adh1 PE=1 SV=2 1 215 1.0E-07
sp|P14940|ADH_CUPNE Alcohol dehydrogenase OS=Cupriavidus necator GN=adh PE=3 SV=1 1 216 1.0E-07
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1 216 2.0E-07
sp|P86883|ADH1_COLLI Alcohol dehydrogenase 1 OS=Columba livia GN=ADH1 PE=1 SV=1 25 206 2.0E-07
sp|P23991|ADH1_CHICK Alcohol dehydrogenase 1 OS=Gallus gallus GN=ADH1 PE=1 SV=2 13 213 3.0E-07
sp|Q8NVD1|ZDH1_STAAW Zinc-type alcohol dehydrogenase-like protein MW2112 OS=Staphylococcus aureus (strain MW2) GN=MW2112 PE=3 SV=1 2 87 4.0E-07
sp|Q6G7C8|ZDH1_STAAS Zinc-type alcohol dehydrogenase-like protein SAS2087 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2087 PE=3 SV=1 2 87 4.0E-07
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 25 215 5.0E-07
sp|Q5HE19|ZDH1_STAAC Zinc-type alcohol dehydrogenase-like protein SACOL2177 OS=Staphylococcus aureus (strain COL) GN=SACOL2177 PE=3 SV=1 2 87 5.0E-07
sp|P25405|ADH1A_SAAHA Alcohol dehydrogenase 1A OS=Saara hardwickii PE=1 SV=2 31 211 5.0E-07
sp|P30350|ADH1_ANAPL Alcohol dehydrogenase 1 (Fragment) OS=Anas platyrhynchos GN=ADH1 PE=2 SV=1 42 206 5.0E-07
sp|Q91YR9|PTGR1_MOUSE Prostaglandin reductase 1 OS=Mus musculus GN=Ptgr1 PE=1 SV=2 2 133 6.0E-07
sp|P97584|PTGR1_RAT Prostaglandin reductase 1 OS=Rattus norvegicus GN=Ptgr1 PE=2 SV=3 2 133 6.0E-07
sp|Q8CRJ7|ZDH1_STAES Zinc-type alcohol dehydrogenase-like protein SE_1777 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_1777 PE=3 SV=1 2 87 1.0E-06
sp|Q5HM44|ZDH1_STAEQ Zinc-type alcohol dehydrogenase-like protein SERP1785 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP1785 PE=3 SV=1 2 87 1.0E-06
sp|B4F134|TDH_PROMH L-threonine 3-dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=tdh PE=3 SV=1 23 216 1.0E-06
sp|P80512|ADH1_NAJNA Alcohol dehydrogenase 1 OS=Naja naja PE=1 SV=1 31 213 1.0E-06
sp|Q3IZ91|CCR_RHOS4 Crotonyl-CoA reductase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ccr PE=3 SV=1 2 207 1.0E-06
sp|P19631|ADH1_COTJA Alcohol dehydrogenase 1 OS=Coturnix coturnix japonica GN=ADH1 PE=1 SV=1 13 213 2.0E-06
sp|P25406|ADH1B_SAAHA Alcohol dehydrogenase 1B OS=Saara hardwickii PE=1 SV=2 25 206 2.0E-06
sp|P07754|ADH3_EMENI Alcohol dehydrogenase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcC PE=3 SV=1 1 215 2.0E-06
sp|Q9EQZ5|PTGR1_CAVPO Prostaglandin reductase 1 OS=Cavia porcellus GN=Ptgr1 PE=1 SV=1 2 133 2.0E-06
sp|Q6WAU0|PULR_MENPI (+)-pulegone reductase OS=Mentha piperita PE=1 SV=1 13 215 2.0E-06
sp|Q8KQL2|ARPD_ENTAV D-arabitol-phosphate dehydrogenase OS=Enterococcus avium PE=1 SV=1 1 214 3.0E-06
sp|P73138|FRMA_SYNY3 S-(hydroxymethyl)glutathione dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=frmA PE=3 SV=1 13 206 3.0E-06
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1 141 3.0E-06
sp|P80338|ADH1_STRCA Alcohol dehydrogenase 1 OS=Struthio camelus GN=ADH1 PE=1 SV=1 31 206 3.0E-06
sp|Q17334|ADH1_CAEEL Alcohol dehydrogenase 1 OS=Caenorhabditis elegans GN=sodh-1 PE=2 SV=2 4 187 4.0E-06
sp|P99173|ZDH1_STAAN Zinc-type alcohol dehydrogenase-like protein SA1988 OS=Staphylococcus aureus (strain N315) GN=SA1988 PE=1 SV=1 2 87 4.0E-06
sp|P63475|ZDH1_STAAM Zinc-type alcohol dehydrogenase-like protein SAV2186 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2186 PE=3 SV=1 2 87 4.0E-06
sp|Q7NXH5|TDH_CHRVO L-threonine 3-dehydrogenase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tdh PE=3 SV=1 34 214 4.0E-06
sp|Q9Z9U1|DHSO_BACHD Sorbitol dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gutB PE=3 SV=1 28 167 4.0E-06
sp|P44557|FRMA_HAEIN S-(hydroxymethyl)glutathione dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=frmA PE=3 SV=1 13 206 4.0E-06
sp|Q6GEP3|ZDH1_STAAR Zinc-type alcohol dehydrogenase-like protein SAR2277 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2277 PE=3 SV=1 2 87 5.0E-06
sp|P28469|ADH1A_MACMU Alcohol dehydrogenase 1A OS=Macaca mulatta GN=ADH1A PE=2 SV=2 31 206 6.0E-06
sp|O23939|ENOX_FRAVE 2-methylene-furan-3-one reductase OS=Fragaria vesca GN=EO PE=2 SV=2 2 213 8.0E-06
sp|A4IZ92|TDH_FRATW L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=tdh PE=3 SV=1 1 214 8.0E-06
sp|Q5NGW4|TDH_FRATT L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=tdh PE=3 SV=1 1 214 8.0E-06
sp|Q14IB6|TDH_FRAT1 L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=tdh PE=3 SV=1 1 214 8.0E-06
sp|A0Q5K3|TDH_FRATN L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. novicida (strain U112) GN=tdh PE=3 SV=1 1 214 8.0E-06
sp|Q3SZJ4|PTGR1_BOVIN Prostaglandin reductase 1 OS=Bos taurus GN=PTGR1 PE=2 SV=1 2 135 9.0E-06
sp|Q0BKV5|TDH_FRATO L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=tdh PE=3 SV=1 1 214 9.0E-06
sp|Q2A282|TDH_FRATH L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=tdh PE=3 SV=1 1 214 9.0E-06
sp|A7NDM9|TDH_FRATF L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=tdh PE=3 SV=1 1 214 9.0E-06
sp|P49645|ADH1_APTAU Alcohol dehydrogenase 1 OS=Apteryx australis GN=ADH1 PE=1 SV=2 31 213 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5575
MPSNLSMLEASTLSCAGLTAWNALYGPADNQIKAGDWVLTQGTGGVSIFALQFAKAAGARVVATTGSNEKIATLK
RLGADYIINYKETHEWGAEAKRLTGGQGFDHIIEVAGPASMAQSLDAIKINGVISIVGFVGGDSSGKDQPSFLEC
LRKQCTARGIGIGSRVQMEDMCRAIEANPAKLRPLVDKTFPLEQVKEGLEYLYAGKHFGKVCIDIQ*
Coding >Hirsu2|5575
ATGCCGAGTAACCTTTCTATGCTCGAGGCGTCGACGCTCTCGTGTGCCGGCCTAACGGCCTGGAACGCTCTCTAC
GGCCCAGCGGATAACCAGATCAAGGCGGGAGACTGGGTCCTTACCCAGGGGACCGGCGGCGTTAGCATCTTCGCC
CTACAATTCGCTAAGGCGGCCGGCGCAAGGGTCGTCGCGACAACGGGCTCAAACGAGAAGATCGCCACCCTCAAG
AGGCTTGGCGCGGACTATATCATCAACTATAAGGAAACGCACGAGTGGGGCGCCGAGGCGAAGAGGTTGACCGGC
GGCCAAGGCTTTGACCACATCATCGAAGTCGCCGGCCCCGCCTCCATGGCCCAGAGTCTAGATGCCATAAAAATC
AACGGCGTCATCTCCATCGTCGGATTTGTCGGCGGCGACTCGAGTGGAAAAGATCAGCCCAGCTTCCTTGAATGC
CTAAGAAAGCAGTGTACGGCCCGAGGCATCGGTATCGGCAGCCGAGTTCAGATGGAGGACATGTGTCGCGCCATT
GAGGCCAACCCAGCAAAGTTGCGGCCGCTAGTCGATAAGACTTTCCCGCTGGAGCAGGTCAAGGAGGGGTTGGAG
TACTTATACGCCGGCAAGCACTTTGGAAAGGTTTGTATCGATATACAGTGA
Transcript >Hirsu2|5575
ATGCCGAGTAACCTTTCTATGCTCGAGGCGTCGACGCTCTCGTGTGCCGGCCTAACGGCCTGGAACGCTCTCTAC
GGCCCAGCGGATAACCAGATCAAGGCGGGAGACTGGGTCCTTACCCAGGGGACCGGCGGCGTTAGCATCTTCGCC
CTACAATTCGCTAAGGCGGCCGGCGCAAGGGTCGTCGCGACAACGGGCTCAAACGAGAAGATCGCCACCCTCAAG
AGGCTTGGCGCGGACTATATCATCAACTATAAGGAAACGCACGAGTGGGGCGCCGAGGCGAAGAGGTTGACCGGC
GGCCAAGGCTTTGACCACATCATCGAAGTCGCCGGCCCCGCCTCCATGGCCCAGAGTCTAGATGCCATAAAAATC
AACGGCGTCATCTCCATCGTCGGATTTGTCGGCGGCGACTCGAGTGGAAAAGATCAGCCCAGCTTCCTTGAATGC
CTAAGAAAGCAGTGTACGGCCCGAGGCATCGGTATCGGCAGCCGAGTTCAGATGGAGGACATGTGTCGCGCCATT
GAGGCCAACCCAGCAAAGTTGCGGCCGCTAGTCGATAAGACTTTCCCGCTGGAGCAGGTCAAGGAGGGGTTGGAG
TACTTATACGCCGGCAAGCACTTTGGAAAGGTTTGTATCGATATACAGTGA
Gene >Hirsu2|5575
ATGCCGAGTAACCTTTCTATGCTCGAGGCGTCGACGCTCTCGTGTGCCGGCCTAACGGCCTGGAACGCTCTCTAC
GGCCCAGCGGATAACCAGATCAAGGCGGGAGACTGGGTCCTTACCCAGGGGACCGGCGGCGTTAGCATCTTCGCC
CTACAATTCGCTAAGGCGGCCGGCGCAAGGGTCGTCGCGACAACGGGCTCAAACGAGAAGATCGCCACCCTCAAG
AGGCTTGGCGCGGACTATATCATCAACTATAAGGAAACGCACGAGTGGGGCGCCGAGGCGAAGAGGTTGACCGGC
GGCCAAGGCTTTGACCACATCATCGAAGTCGCCGGCCCCGCCTCCATGGCCCAGAGTCTAGATGCCATAAAAATC
AACGGCGTCATCTCCATCGTCGGATTTGTCGGCGGCGACTCGAGTGGAAAAGATCAGCCCAGCTTCCTTGAATGC
CTAAGAAAGCAGTGTACGGCCCGAGGCATCGGTATCGGCAGCCGAGTTCAGATGGAGGACATGTGTCGCGCCATT
GAGGCCAACCCAGCAAAGTTGCGGCCGCTAGTCGATAAGACTTTCCCGCTGGAGCAGGTCAAGGAGGGGTTGGAG
TACTTATACGCCGGCAAGCACTTTGGAAAGGTTTGTATCGATATACAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail