Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5572
Gene name
LocationContig_28:6664..8220
Strand-
Gene length (bp)1556
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06738 ThrE Putative threonine/serine exporter 2.3E-11 91 166
PF06738 ThrE Putative threonine/serine exporter 1.5E-29 166 308
PF12821 ThrE_2 Threonine/Serine exporter, ThrE 4.4E-09 334 474

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14267|YFPC_SCHPO Uncharacterized UPF0442 protein C7D4.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC7D4.12c PE=3 SV=1 30 495 4.0E-111
sp|Q6BVE3|PRM10_DEBHA Pheromone-regulated membrane protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2C03278g PE=3 SV=2 88 495 3.0E-105
sp|Q6C4Q0|PRM10_YARLI Pheromone-regulated membrane protein 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E24651g PE=3 SV=1 88 495 3.0E-104
sp|C4YTQ0|PRM10_CANAW Pheromone-regulated membrane protein 10 OS=Candida albicans (strain WO-1) GN=CAWG_05545 PE=3 SV=1 88 495 1.0E-102
sp|Q5AH11|PRM10_CANAL Pheromone-regulated membrane protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRM10 PE=3 SV=1 88 495 1.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14267|YFPC_SCHPO Uncharacterized UPF0442 protein C7D4.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC7D4.12c PE=3 SV=1 30 495 4.0E-111
sp|Q6BVE3|PRM10_DEBHA Pheromone-regulated membrane protein 10 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2C03278g PE=3 SV=2 88 495 3.0E-105
sp|Q6C4Q0|PRM10_YARLI Pheromone-regulated membrane protein 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E24651g PE=3 SV=1 88 495 3.0E-104
sp|C4YTQ0|PRM10_CANAW Pheromone-regulated membrane protein 10 OS=Candida albicans (strain WO-1) GN=CAWG_05545 PE=3 SV=1 88 495 1.0E-102
sp|Q5AH11|PRM10_CANAL Pheromone-regulated membrane protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRM10 PE=3 SV=1 88 495 1.0E-102
sp|C5E109|PRM10_ZYGRC Pheromone-regulated membrane protein 10 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=ZYRO0G17116g PE=3 SV=1 88 495 8.0E-101
sp|Q6FT92|PRM10_CANGA Pheromone-regulated membrane protein 10 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0G04433g PE=3 SV=1 87 495 2.0E-97
sp|Q9UVG5|PRM10_PICSO Pheromone-regulated membrane protein 10 OS=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) GN=GNLVRS01_PISO0A10120g PE=3 SV=2 88 495 1.0E-95
sp|Q754J7|PRM10_ASHGO Pheromone-regulated membrane protein 10 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AFR075C PE=3 SV=1 65 495 3.0E-95
sp|A6ZQL9|PRM10_YEAS7 Pheromone-regulated membrane protein 10 OS=Saccharomyces cerevisiae (strain YJM789) GN=PRM10 PE=3 SV=1 35 495 7.0E-95
sp|Q6CLI2|PRM10_KLULA Pheromone-regulated membrane protein 10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F02816g PE=3 SV=1 88 495 2.0E-92
sp|P42946|PRM10_YEAST Pheromone-regulated membrane protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRM10 PE=1 SV=1 133 494 3.0E-76
sp|P87293|YDN1_SCHPO Uncharacterized UPF0442 protein C16A10.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16A10.01 PE=3 SV=1 88 488 3.0E-67
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 254 276 22
2 289 311 22
3 326 345 19
4 374 396 22
5 411 433 22
6 459 481 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5572
MAVSPSTCCSSSGPAPCPCSSSPFSSATARQASTADSAASTTDCSASATDPVPAPAADPARAEGPSRRRRNGSDT
EAGVTGPDGTASRKTYVVDMSRALILFGAPTHRLEQYLQHTSRALGLPLQSYYLPGCMTVSFGPGDVHMIRCAQA
LNLAKLHDVHRVYKDVFPCWLRVLSYGLACACIGPVSFNAQPVDLPVIFVLGSLVGFLELVLAPRNELYGYVFDV
SSAVLSSCLGRAFGSVHWGGGRHRFCFPAIAQAPIVMILPGFTITNSALELQSRNVVSGAVRLVYGVVFTLFLAF
GFTVGIAIYGAVDGNATSVTKCEPSFAVWWPLAFVLPFTFCYVVVNQARWRNMPAMLAVALAGWAVNHFSAERLA
AVPALPQALGALAVGVLANLYSRLGRGLAAALMQPAIFIQVPGSLAASGSLISGLTNADRLIRNVRNATDPLSYR
QATVSELDAGYAMVNIAIGITVGLSVSVILVYPLRKKGSSGIFSF*
Coding >Hirsu2|5572
ATGGCGGTCTCGCCGTCTACTTGCTGCAGCAGCTCCGGTCCGGCCCCGTGTCCCTGCTCCTCCTCCCCCTTCTCC
TCTGCGACGGCTCGGCAGGCCTCGACGGCGGATTCGGCCGCGTCGACCACGGATTGTTCGGCCTCGGCTACGGAT
CCGGTTCCGGCGCCGGCCGCGGATCCGGCCCGGGCGGAGGGGCCGAGCCGGCGGCGGCGTAACGGCAGCGACACC
GAGGCCGGCGTCACGGGCCCGGACGGCACGGCCAGCCGCAAGACCTACGTCGTCGACATGAGCCGCGCGCTCATC
CTGTTCGGCGCGCCGACTCACCGACTGGAGCAGTACCTGCAGCACACGTCGCGGGCGCTGGGGCTGCCGCTGCAG
TCGTACTACCTGCCCGGCTGCATGACCGTCTCCTTCGGCCCCGGCGACGTGCACATGATCCGGTGCGCGCAGGCG
CTCAACCTGGCCAAGCTGCACGACGTGCACCGCGTCTACAAGGACGTCTTCCCCTGCTGGCTGCGCGTGCTGTCG
TACGGGCTGGCCTGCGCCTGCATCGGCCCCGTCTCGTTCAACGCCCAGCCGGTCGACCTGCCCGTCATCTTCGTC
CTCGGCAGCCTCGTCGGCTTCCTCGAGCTGGTGCTGGCGCCGCGCAACGAGCTGTACGGCTACGTCTTCGACGTC
TCGTCCGCTGTGCTGTCGTCGTGCCTCGGCCGTGCCTTCGGCTCCGTCCACTGGGGCGGCGGCCGCCACCGCTTC
TGCTTCCCGGCCATCGCCCAGGCGCCCATCGTCATGATCCTGCCGGGCTTCACCATCACCAACAGCGCGCTGGAG
CTGCAGTCTAGGAACGTCGTCTCCGGCGCCGTCCGGCTCGTCTACGGCGTCGTCTTCACCCTGTTCCTGGCCTTT
GGCTTCACTGTCGGAATCGCCATCTATGGCGCCGTCGACGGCAACGCCACCTCCGTCACCAAGTGCGAGCCCAGC
TTCGCCGTCTGGTGGCCCCTGGCCTTCGTCCTCCCCTTCACCTTTTGCTACGTCGTCGTCAACCAAGCTCGGTGG
CGCAACATGCCCGCCATGCTGGCCGTCGCCCTGGCCGGCTGGGCCGTCAACCACTTCTCTGCCGAGCGCCTGGCC
GCCGTGCCCGCTCTGCCCCAGGCCTTGGGCGCCCTGGCCGTGGGCGTGCTGGCGAACTTGTATTCGCGCCTCGGG
CGCGGCCTGGCCGCCGCCCTGATGCAGCCCGCCATCTTCATTCAGGTGCCCGGCAGTCTGGCCGCCTCCGGCAGC
CTCATCAGCGGCCTGACCAATGCCGACCGGCTCATCCGCAACGTCCGCAACGCGACCGATCCCCTCTCGTACCGA
CAGGCCACCGTCTCCGAGCTCGACGCCGGCTACGCAATGGTCAACATCGCCATCGGCATCACCGTTGGCTTGTCC
GTCAGTGTCATTCTCGTCTATCCGCTGCGGAAGAAGGGCAGCAGCGGTATATTCAGCTTCTAA
Transcript >Hirsu2|5572
ATGGCGGTCTCGCCGTCTACTTGCTGCAGCAGCTCCGGTCCGGCCCCGTGTCCCTGCTCCTCCTCCCCCTTCTCC
TCTGCGACGGCTCGGCAGGCCTCGACGGCGGATTCGGCCGCGTCGACCACGGATTGTTCGGCCTCGGCTACGGAT
CCGGTTCCGGCGCCGGCCGCGGATCCGGCCCGGGCGGAGGGGCCGAGCCGGCGGCGGCGTAACGGCAGCGACACC
GAGGCCGGCGTCACGGGCCCGGACGGCACGGCCAGCCGCAAGACCTACGTCGTCGACATGAGCCGCGCGCTCATC
CTGTTCGGCGCGCCGACTCACCGACTGGAGCAGTACCTGCAGCACACGTCGCGGGCGCTGGGGCTGCCGCTGCAG
TCGTACTACCTGCCCGGCTGCATGACCGTCTCCTTCGGCCCCGGCGACGTGCACATGATCCGGTGCGCGCAGGCG
CTCAACCTGGCCAAGCTGCACGACGTGCACCGCGTCTACAAGGACGTCTTCCCCTGCTGGCTGCGCGTGCTGTCG
TACGGGCTGGCCTGCGCCTGCATCGGCCCCGTCTCGTTCAACGCCCAGCCGGTCGACCTGCCCGTCATCTTCGTC
CTCGGCAGCCTCGTCGGCTTCCTCGAGCTGGTGCTGGCGCCGCGCAACGAGCTGTACGGCTACGTCTTCGACGTC
TCGTCCGCTGTGCTGTCGTCGTGCCTCGGCCGTGCCTTCGGCTCCGTCCACTGGGGCGGCGGCCGCCACCGCTTC
TGCTTCCCGGCCATCGCCCAGGCGCCCATCGTCATGATCCTGCCGGGCTTCACCATCACCAACAGCGCGCTGGAG
CTGCAGTCTAGGAACGTCGTCTCCGGCGCCGTCCGGCTCGTCTACGGCGTCGTCTTCACCCTGTTCCTGGCCTTT
GGCTTCACTGTCGGAATCGCCATCTATGGCGCCGTCGACGGCAACGCCACCTCCGTCACCAAGTGCGAGCCCAGC
TTCGCCGTCTGGTGGCCCCTGGCCTTCGTCCTCCCCTTCACCTTTTGCTACGTCGTCGTCAACCAAGCTCGGTGG
CGCAACATGCCCGCCATGCTGGCCGTCGCCCTGGCCGGCTGGGCCGTCAACCACTTCTCTGCCGAGCGCCTGGCC
GCCGTGCCCGCTCTGCCCCAGGCCTTGGGCGCCCTGGCCGTGGGCGTGCTGGCGAACTTGTATTCGCGCCTCGGG
CGCGGCCTGGCCGCCGCCCTGATGCAGCCCGCCATCTTCATTCAGGTGCCCGGCAGTCTGGCCGCCTCCGGCAGC
CTCATCAGCGGCCTGACCAATGCCGACCGGCTCATCCGCAACGTCCGCAACGCGACCGATCCCCTCTCGTACCGA
CAGGCCACCGTCTCCGAGCTCGACGCCGGCTACGCAATGGTCAACATCGCCATCGGCATCACCGTTGGCTTGTCC
GTCAGTGTCATTCTCGTCTATCCGCTGCGGAAGAAGGGCAGCAGCGGTATATTCAGCTTCTAA
Gene >Hirsu2|5572
ATGGCGGTCTCGCCGTCTACTTGCTGCAGCAGCTCCGGTCCGGCCCCGTGTCCCTGCTCCTCCTCCCCCTTCTCC
TCTGCGACGGCTCGGCAGGCCTCGACGGCGGATTCGGCCGCGTCGACCACGGATTGTTCGGCCTCGGCTACGGAT
CCGGTTCCGGCGCCGGCCGCGGATCCGGCCCGGGCGGAGGGGCCGAGCCGGCGGCGGCGTAACGGCAGCGACACC
GAGGCCGGCGTCACGGGCCCGGACGGCACGGCCAGCCGCAAGACCTACGTCGTCGACATGAGCCGCGCGCTCATC
CTGTTCGGCGCGCCGACTCACCGACTGGAGCAGTACCTGCAGCACACGTCGCGGGCGCTGGGGCTGCCGCTGCAG
TCGTACTACCTGCCCGGCTGCATGACCGTCTCCTTCGGCCCCGGCGACGTGCACATGATCCGGTGCGCGCAGGCG
CTCAACCTGGCCAAGCTGCACGACGTGCACCGCGTCTACAAGGACGTCGTGCACGGGGCCACGACGACCGACGCC
GCCGTCGCCGCCCTGGCCGACATCGTCGCCGGCCCGGACAGTTCCCCTGCTGGCTGCGCGTGCTGTCGTACGGGC
TGGCCTGCGCCTGCATCGGCCCCGTCTCGTTCAACGCCCAGCCGGTCGACCTGCCCGTCATCTTCGTCCTCGGCA
GCCTCGTCGGCTTCCTCGAGCTGGTGCTGGCGCCGCGCAACGAGCTGTACGGCTACGTCTTCGACGTCTCGTCCG
CTGTGCTGTCGTCGTGCCTCGGCCGTGCCTTCGGCTCCGTCCACTGGGGCGGCGGCCGCCACCGCTTCTGCTTCC
CGGCCATCGCCCAGGCGCCCATCGTCATGATCCTGCCGGGCTTCACCATCACCAACAGCGCGCTGGAGCTGCAGT
CTAGGAACGTCGTCTCCGGCGCCGTCCGGCTCGTCTACGGCGTCGTCTTCACCCTGTTCCTGGCCTTTGGCTTCA
CTGTCGGAATCGCCATCTATGGCGCCGTCGACGGCAACGCCACCTCCGTCACCAAGTGCGAGCCCAGCTTCGCCG
TCTGGTGGCCCCTGGCCTTCGTCCTCCCCTTCACCTTTTGCTACGTCGTCGTCAACCAAGCTCGGTGGCGCAACA
TGCCCGCCATGCTGGCCGTCGCCCTGGCCGGCTGGGCCGTCAACCACTTCTCTGCCGAGCGCCTGGCCGCCGTGC
CCGCTCTGCCCCAGGCCTTGGGCGCCCTGGCCGTGGGCGTGCTGGCGAACTTGTATTCGCGCCTCGGGCGCGGCC
TGGCCGCCGCCCTGATGCAGCCCGCCATCTTCATTCAGGTGCCCGGCAGTCTGGCCGCCTCCGGCAGCCTCATCA
GCGGCCTGACCAATGCCGACCGGCTCATCCGCAACGTCCGCAACGCGACCGATCCCCTCTCGTACCGACAGGCCA
CCGTCTCCGAGCTCGACGCCGGCTACGCAATGGTCAACATCGCCATCGGCATCACCGTTGGCTTGTCCGTCAGTG
TCATTCTCGTCTATCCGCTGCGGAAGAAGGGCAGCAGCGGTATATTCAGCTTCTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail