Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5566
Gene name
LocationContig_2792:1172..1601
Strand-
Gene length (bp)429
Transcript length (bp)294
Coding sequence length (bp)294
Protein length (aa) 98

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06645 SPC12 Microsomal signal peptidase 12 kDa subunit (SPC12) 2.2E-28 17 85

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O44953|SPCS1_CAEEL Probable signal peptidase complex subunit 1 OS=Caenorhabditis elegans GN=C34B2.10 PE=3 SV=1 13 82 6.0E-14
sp|Q61CQ8|SPCS1_CAEBR Probable signal peptidase complex subunit 1 OS=Caenorhabditis briggsae GN=CBG12804 PE=3 SV=1 13 82 3.0E-13
sp|Q944J0|SPCS1_ARATH Probable signal peptidase complex subunit 1 OS=Arabidopsis thaliana GN=At2g22425 PE=2 SV=1 17 83 9.0E-13
sp|Q3T134|SPCS1_BOVIN Signal peptidase complex subunit 1 OS=Bos taurus GN=SPCS1 PE=3 SV=1 17 94 6.0E-12
sp|Q5RF96|SPCS1_PONAB Signal peptidase complex subunit 1 OS=Pongo abelii GN=SPCS1 PE=3 SV=1 17 94 7.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O44953|SPCS1_CAEEL Probable signal peptidase complex subunit 1 OS=Caenorhabditis elegans GN=C34B2.10 PE=3 SV=1 13 82 6.0E-14
sp|Q61CQ8|SPCS1_CAEBR Probable signal peptidase complex subunit 1 OS=Caenorhabditis briggsae GN=CBG12804 PE=3 SV=1 13 82 3.0E-13
sp|Q944J0|SPCS1_ARATH Probable signal peptidase complex subunit 1 OS=Arabidopsis thaliana GN=At2g22425 PE=2 SV=1 17 83 9.0E-13
sp|Q3T134|SPCS1_BOVIN Signal peptidase complex subunit 1 OS=Bos taurus GN=SPCS1 PE=3 SV=1 17 94 6.0E-12
sp|Q5RF96|SPCS1_PONAB Signal peptidase complex subunit 1 OS=Pongo abelii GN=SPCS1 PE=3 SV=1 17 94 7.0E-12
sp|Q9Y6A9|SPCS1_HUMAN Signal peptidase complex subunit 1 OS=Homo sapiens GN=SPCS1 PE=1 SV=4 17 94 7.0E-12
sp|B0FWK4|SPCS1_PIG Signal peptidase complex subunit 1 OS=Sus scrofa GN=SPCS1 PE=3 SV=1 16 94 7.0E-12
sp|Q9D958|SPCS1_MOUSE Signal peptidase complex subunit 1 OS=Mus musculus GN=Spcs1 PE=2 SV=3 17 84 4.0E-11
sp|G2TRR4|SPC1_SCHPO Microsomal signal peptidase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=new19 PE=2 SV=1 11 82 6.0E-09
sp|Q9VAL0|SPCS1_DROME Signal peptidase complex subunit 1 OS=Drosophila melanogaster GN=Spase12 PE=1 SV=2 13 82 7.0E-09
sp|P46965|SPC1_YEAST Signal peptidase complex subunit SPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC1 PE=1 SV=1 1 82 3.0E-08
sp|Q54Y83|SPCS1_DICDI Signal peptidase complex subunit 1 OS=Dictyostelium discoideum GN=spcs1 PE=3 SV=1 17 82 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0008233 peptidase activity Yes
GO:0005787 signal peptidase complex Yes
GO:0006465 signal peptide processing Yes
GO:0044446 intracellular organelle part No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0032991 protein-containing complex No
GO:0044424 intracellular part No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0044432 endoplasmic reticulum part No
GO:0051604 protein maturation No
GO:0019538 protein metabolic process No
GO:0016485 protein processing No
GO:0044444 cytoplasmic part No
GO:0044464 cell part No
GO:0044425 membrane part No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0031224 intrinsic component of membrane No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1902494 catalytic complex No
GO:0071704 organic substance metabolic process No
GO:1905368 peptidase complex No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0044267 cellular protein metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0044260 cellular macromolecule metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0003674 molecular_function No
GO:0044422 organelle part No
GO:0098796 membrane protein complex No
GO:0006508 proteolysis No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 27 46 19
2 53 75 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5566
MAEEILDKIRDLVDGSIDFDGQRRAEGFATILLAISGLLAFNIGYHSQDIQKAVFVGLGGTALTFLLVVPPWPFY
NRNPVKWLPAGSGWQPDRQAHA*
Coding >Hirsu2|5566
ATGGCGGAGGAGATTCTTGACAAGATTCGCGATCTGGTAGACGGGTCTATTGACTTCGATGGTCAGCGGCGCGCT
GAGGGATTCGCTACGATCCTGCTTGCTATCTCCGGGTTGCTGGCATTCAACATCGGCTACCATAGCCAAGATATT
CAGAAGGCTGTTTTCGTCGGGTTGGGGGGGACCGCCCTAACGTTCCTCCTCGTCGTGCCGCCATGGCCATTCTAT
AATAGGAATCCTGTTAAATGGCTGCCGGCCGGTTCTGGATGGCAACCGGATAGACAAGCCCACGCGTGA
Transcript >Hirsu2|5566
ATGGCGGAGGAGATTCTTGACAAGATTCGCGATCTGGTAGACGGGTCTATTGACTTCGATGGTCAGCGGCGCGCT
GAGGGATTCGCTACGATCCTGCTTGCTATCTCCGGGTTGCTGGCATTCAACATCGGCTACCATAGCCAAGATATT
CAGAAGGCTGTTTTCGTCGGGTTGGGGGGGACCGCCCTAACGTTCCTCCTCGTCGTGCCGCCATGGCCATTCTAT
AATAGGAATCCTGTTAAATGGCTGCCGGCCGGTTCTGGATGGCAACCGGATAGACAAGCCCACGCGTGA
Gene >Hirsu2|5566
ATGGCGGAGGAGATTCTTGACAAGATTCGCGATCTGGTAGACGGGTCTATTGTAGGATTTCCAGCGAAAATACAA
CGCGGCGCATCTGGCGAGTCCTATTTGGCATTACTAATTCAGCATGTACAGGACTTCGATGGTCAGCGGCGCGCT
GAGGGATTCGCTACGATCCTGCTTGCTATCTCCGGGGTAATACGCAATCGTCCACGCTCCGACAGCCACTCGAAG
TGCTAACTGTGCCGCCTAAAGTTGCTGGCATTCAACATCGGCTACCATAGCCAAGATATTCAGAAGGCTGTTTTC
GTCGGGTTGGGGGGGACCGCCCTAACGTTCCTCCTCGTCGTGCCGCCATGGCCATTCTATAATAGGAATCCTGTT
AAATGGCTGCCGGCCGGTTCTGGATGGCAACCGGATAGACAAGCCCACGCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail