Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5555
Gene name
LocationContig_2788:627..1407
Strand-
Gene length (bp)780
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04818 CTD_bind RNA polymerase II-binding domain. 1.5E-18 55 117

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74814|YJ03_SCHPO UPF0400 protein C337.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC337.03 PE=1 SV=1 1 129 4.0E-30
sp|Q5R8Y3|RPR1A_PONAB Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Pongo abelii GN=RPRD1A PE=2 SV=1 2 135 2.0E-17
sp|Q96P16|RPR1A_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens GN=RPRD1A PE=1 SV=1 2 135 2.0E-17
sp|Q0P5J9|RPR1A_BOVIN Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Bos taurus GN=RPRD1A PE=2 SV=2 2 135 2.0E-17
sp|Q8VDS4|RPR1A_MOUSE Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Mus musculus GN=Rprd1a PE=1 SV=1 2 121 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74814|YJ03_SCHPO UPF0400 protein C337.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC337.03 PE=1 SV=1 1 129 4.0E-30
sp|Q5R8Y3|RPR1A_PONAB Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Pongo abelii GN=RPRD1A PE=2 SV=1 2 135 2.0E-17
sp|Q96P16|RPR1A_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens GN=RPRD1A PE=1 SV=1 2 135 2.0E-17
sp|Q0P5J9|RPR1A_BOVIN Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Bos taurus GN=RPRD1A PE=2 SV=2 2 135 2.0E-17
sp|Q8VDS4|RPR1A_MOUSE Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Mus musculus GN=Rprd1a PE=1 SV=1 2 121 2.0E-17
sp|Q9NQG5|RPR1B_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens GN=RPRD1B PE=1 SV=1 2 131 2.0E-17
sp|Q9CSU0|RPR1B_MOUSE Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Mus musculus GN=Rprd1b PE=1 SV=2 2 131 2.0E-17
sp|Q5ZM30|RPR1A_CHICK Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Gallus gallus GN=RPRD1A PE=2 SV=1 2 121 1.0E-16
sp|Q05543|RT103_YEAST Regulator of Ty1 transposition protein 103 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RTT103 PE=1 SV=1 1 130 6.0E-14
sp|Q6NXI6|RPRD2_MOUSE Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Mus musculus GN=Rprd2 PE=1 SV=1 11 135 6.0E-11
sp|Q5VT52|RPRD2_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens GN=RPRD2 PE=1 SV=1 11 117 2.0E-10
sp|P34281|CIDS1_CAEEL CID domain-containing protein 1 OS=Caenorhabditis elegans GN=cids-1 PE=3 SV=2 3 117 7.0E-09
sp|A8WLG6|CIDS1_CAEBR CID domain-containing protein 1 OS=Caenorhabditis briggsae GN=cids-1 PE=3 SV=1 3 117 1.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5555
MAYNDDSVLARLSSLNESHDSIATAAQWIMFHRRHADRTVQLWMQRLKDSSSTKRLSLVYLANEVVQQSRIRHKE
DFVTAFSPVIAEATAIAYKGAPAEIQAKLRRVVDVWKDRSIFEGPIQGAIEVRLEELDKARGI*
Coding >Hirsu2|5555
ATGGCGTACAACGACGACTCAGTGCTGGCACGACTGTCGTCGCTGAACGAGAGTCACGACAGTATCGCGACGGCA
GCGCAGTGGATCATGTTTCATCGAAGGCACGCAGACCGCACGGTACAGCTTTGGATGCAGCGATTAAAGGATTCA
TCCAGCACTAAGCGCCTCAGTCTGGTTTATCTCGCTAACGAGGTTGTTCAACAGTCTCGCATACGTCACAAAGAG
GACTTCGTCACAGCCTTTTCTCCTGTCATTGCTGAGGCTACCGCCATCGCATACAAAGGAGCTCCCGCGGAGATT
CAGGCCAAGTTGAGACGTGTGGTGGATGTGTGGAAGGACAGATCCATCTTCGAAGGGCCAATTCAAGGCGCCATC
GAGGTTAGACTTGAAGAGCTGGATAAAGCCCGGGGAATATGA
Transcript >Hirsu2|5555
ATGGCGTACAACGACGACTCAGTGCTGGCACGACTGTCGTCGCTGAACGAGAGTCACGACAGTATCGCGACGGCA
GCGCAGTGGATCATGTTTCATCGAAGGCACGCAGACCGCACGGTACAGCTTTGGATGCAGCGATTAAAGGATTCA
TCCAGCACTAAGCGCCTCAGTCTGGTTTATCTCGCTAACGAGGTTGTTCAACAGTCTCGCATACGTCACAAAGAG
GACTTCGTCACAGCCTTTTCTCCTGTCATTGCTGAGGCTACCGCCATCGCATACAAAGGAGCTCCCGCGGAGATT
CAGGCCAAGTTGAGACGTGTGGTGGATGTGTGGAAGGACAGATCCATCTTCGAAGGGCCAATTCAAGGCGCCATC
GAGGTTAGACTTGAAGAGCTGGATAAAGCCCGGGGAATATGA
Gene >Hirsu2|5555
ATGGCGTACAACGACGACTCAGTGCTGGCACGACTGTCGTCGCTGAACGAGAGTCACGACAGTATCGCGACGGCA
GCGCAGTGGATCATGTTTCATCGGTTCGCCTGCCAAACCAACCTGTACCTTCTTAGATCCCCCATTTATGCTAAC
GCGTTGTACTTCTCACATAGAAGGCACGCAGACCGCACGGTACAGCTTTGGATGCAGCGATTAAAGGATTCATCC
AGCACTAAGCGCCTCAGTCTGGTTTATCTCGCTAACGGTAGGTCGAGGCGAATGGCGTTGCGCTAGTATATAATC
CGCGAACGGGCAAAACCCCGACTAACATTTTTGCCTTTTCTCCCGATACGGTTCCTAGAGGTTGTTCAACAGTCT
CGCATACGTCACAAAGAGGACTTCGTCACAGCCTTTTCTCCTGTCATTGCTGAGGCTACCGCCATCGCATACAAA
GGAGCTCCCGCGGAGATTCAGGCCAAGTTGAGACGTGTGGTGGATGTGTGGAAGGACAGATCCATCTTCGAAGGG
CCAATTCAAGGCGCCATCGAGGTTAGACTTGAAGGTGGTTTCCTAGAAAATGCCGCGTCAGTTGAGAGCAACTGT
TGACAACCGTGCAGAGCTGGATAAAGCCCGGGGTACCGTTAAGCCGGGTTTTGGGGGATCCCCTTTTGCAGCTTC
ATCTGTCCCCCCTGAGTTGACGCCACTGGTCTCTATTCATCAACAAGTATCCAGGTTAAGCGTTCCAGTCAAAAC
GACAGTCTCGTCGGCGAATCAGGAATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail