Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5551
Gene name
LocationContig_2785:97..840
Strand+
Gene length (bp)743
Transcript length (bp)666
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 7.0E-12 90 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N2U9|PQLC1_HUMAN PQ-loop repeat-containing protein 1 OS=Homo sapiens GN=PQLC1 PE=1 SV=1 2 169 6.0E-15
sp|Q03687|YMP0_YEAST Uncharacterized membrane protein YMR010W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR010W PE=1 SV=1 52 168 9.0E-14
sp|Q5M880|PQLC1_RAT PQ-loop repeat-containing protein 1 OS=Rattus norvegicus GN=Pqlc1 PE=1 SV=2 2 169 5.0E-13
sp|Q80XM9|PQLC1_MOUSE PQ-loop repeat-containing protein 1 OS=Mus musculus GN=Pqlc1 PE=1 SV=1 2 169 2.0E-12
sp|Q0VCC1|PQLC1_BOVIN PQ-loop repeat-containing protein 1 OS=Bos taurus GN=PQLC1 PE=2 SV=1 2 170 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8N2U9|PQLC1_HUMAN PQ-loop repeat-containing protein 1 OS=Homo sapiens GN=PQLC1 PE=1 SV=1 2 169 6.0E-15
sp|Q03687|YMP0_YEAST Uncharacterized membrane protein YMR010W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR010W PE=1 SV=1 52 168 9.0E-14
sp|Q5M880|PQLC1_RAT PQ-loop repeat-containing protein 1 OS=Rattus norvegicus GN=Pqlc1 PE=1 SV=2 2 169 5.0E-13
sp|Q80XM9|PQLC1_MOUSE PQ-loop repeat-containing protein 1 OS=Mus musculus GN=Pqlc1 PE=1 SV=1 2 169 2.0E-12
sp|Q0VCC1|PQLC1_BOVIN PQ-loop repeat-containing protein 1 OS=Bos taurus GN=PQLC1 PE=2 SV=1 2 170 1.0E-11
sp|Q6NRS2|PQLC1_XENLA PQ-loop repeat-containing protein 1 OS=Xenopus laevis GN=pqlc1 PE=2 SV=1 2 173 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 64 86 22
2 91 113 22
3 120 142 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5551
MQSLIMVGMQVVLLKIALDHRPGPSSKGGEASLPFAGAQQDNVLSAQRPYNFWQWRSPKPYWQFLIYLFGALLVC
ELLLSFLPPLYAFYSAMLGYIGLSVEATLAIPQILANSQSRSCKGFRLSVLVAWLGGDAMKIFWFFTATTDIPVA
FKVCGLFQAACDCFLGAQYLQYGDGDVDEVVKEHPLEEGQWSSAFMNGPRPHSRSFSQMKGSTLYSDSEAD*
Coding >Hirsu2|5551
ATGCAGTCGCTCATCATGGTTGGCATGCAGGTTGTCCTGCTCAAGATTGCGCTCGACCACCGGCCGGGGCCCTCG
TCCAAGGGCGGCGAGGCCAGTCTGCCCTTTGCCGGCGCGCAGCAGGACAACGTCCTGTCCGCGCAGCGGCCGTAC
AACTTCTGGCAGTGGCGGTCCCCCAAGCCATACTGGCAGTTCCTCATCTACCTCTTCGGGGCCCTGCTCGTCTGC
GAGCTGCTGCTCTCCTTCCTGCCGCCGCTCTACGCCTTCTACTCGGCCATGCTCGGCTACATTGGGCTTTCGGTT
GAGGCCACGCTGGCCATACCGCAGATCCTGGCCAACTCGCAGTCGAGGTCGTGCAAGGGCTTCCGGCTGTCGGTG
CTGGTGGCCTGGCTGGGCGGCGACGCCATGAAGATCTTCTGGTTCTTCACCGCCACGACCGACATACCCGTGGCC
TTCAAGGTGTGCGGCCTGTTCCAGGCGGCGTGCGACTGCTTCCTGGGCGCGCAGTACCTCCAGTACGGCGACGGC
GACGTCGACGAGGTCGTCAAGGAGCACCCGCTGGAGGAGGGCCAGTGGTCGAGCGCCTTCATGAACGGGCCGCGC
CCGCACAGCAGGAGCTTCTCGCAGATGAAGGGCTCGACGCTCTACAGCGACTCCGAGGCCGACTAG
Transcript >Hirsu2|5551
ATGCAGTCGCTCATCATGGTTGGCATGCAGGTTGTCCTGCTCAAGATTGCGCTCGACCACCGGCCGGGGCCCTCG
TCCAAGGGCGGCGAGGCCAGTCTGCCCTTTGCCGGCGCGCAGCAGGACAACGTCCTGTCCGCGCAGCGGCCGTAC
AACTTCTGGCAGTGGCGGTCCCCCAAGCCATACTGGCAGTTCCTCATCTACCTCTTCGGGGCCCTGCTCGTCTGC
GAGCTGCTGCTCTCCTTCCTGCCGCCGCTCTACGCCTTCTACTCGGCCATGCTCGGCTACATTGGGCTTTCGGTT
GAGGCCACGCTGGCCATACCGCAGATCCTGGCCAACTCGCAGTCGAGGTCGTGCAAGGGCTTCCGGCTGTCGGTG
CTGGTGGCCTGGCTGGGCGGCGACGCCATGAAGATCTTCTGGTTCTTCACCGCCACGACCGACATACCCGTGGCC
TTCAAGGTGTGCGGCCTGTTCCAGGCGGCGTGCGACTGCTTCCTGGGCGCGCAGTACCTCCAGTACGGCGACGGC
GACGTCGACGAGGTCGTCAAGGAGCACCCGCTGGAGGAGGGCCAGTGGTCGAGCGCCTTCATGAACGGGCCGCGC
CCGCACAGCAGGAGCTTCTCGCAGATGAAGGGCTCGACGCTCTACAGCGACTCCGAGGCCGACTAG
Gene >Hirsu2|5551
ATGCAGTCGCTCATCATGGTTGGCATGCAGGTTGTCCTGCTCAAGATTGCGCTCGACCACCGGCCGGGGCCCTCG
TCCAAGGGCGGCGAGGCCAGTCTGCCCTTTGCCGGCGCGCAGCAGGACAACGTCCTGTCCGCGCAGCGGCCGTAC
AACTTCTGGCAGTGGCGGTCCCCCAAGCCGTACGTTTTTATCACCGCACCCCTCGTCTTGTTCGTCTCGCACCCG
AGCGCAGTCTCTGACGTCATGTTGTCCATAGATACTGGCAGTTCCTCATCTACCTCTTCGGGGCCCTGCTCGTCT
GCGAGCTGCTGCTCTCCTTCCTGCCGCCGCTCTACGCCTTCTACTCGGCCATGCTCGGCTACATTGGGCTTTCGG
TTGAGGCCACGCTGGCCATACCGCAGATCCTGGCCAACTCGCAGTCGAGGTCGTGCAAGGGCTTCCGGCTGTCGG
TGCTGGTGGCCTGGCTGGGCGGCGACGCCATGAAGATCTTCTGGTTCTTCACCGCCACGACCGACATACCCGTGG
CCTTCAAGGTGTGCGGCCTGTTCCAGGCGGCGTGCGACTGCTTCCTGGGCGCGCAGTACCTCCAGTACGGCGACG
GCGACGTCGACGAGGTCGTCAAGGAGCACCCGCTGGAGGAGGGCCAGTGGTCGAGCGCCTTCATGAACGGGCCGC
GCCCGCACAGCAGGAGCTTCTCGCAGATGAAGGGCTCGACGCTCTACAGCGACTCCGAGGCCGACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail