Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5548
Gene name
LocationContig_2782:1167..1809
Strand-
Gene length (bp)642
Transcript length (bp)642
Coding sequence length (bp)642
Protein length (aa) 214

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01871 AMMECR1 AMMECR1 2.0E-44 38 194

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VCF0|Y5902_DROME Uncharacterized protein CG5902 OS=Drosophila melanogaster GN=CG5902 PE=2 SV=1 49 209 1.0E-42
sp|Q8JZZ6|AMERL_MOUSE AMMECR1-like protein OS=Mus musculus GN=Ammecr1l PE=1 SV=1 49 201 5.0E-42
sp|Q5RDQ3|AMERL_PONAB AMMECR1-like protein OS=Pongo abelii GN=AMMECR1L PE=2 SV=1 49 201 6.0E-42
sp|Q6DCA0|AMERL_HUMAN AMMECR1-like protein OS=Homo sapiens GN=AMMECR1L PE=1 SV=1 49 201 6.0E-42
sp|Q9ZVJ2|AMERL_ARATH Uncharacterized protein At2g38710 OS=Arabidopsis thaliana GN=At2g38710 PE=2 SV=1 49 204 7.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VCF0|Y5902_DROME Uncharacterized protein CG5902 OS=Drosophila melanogaster GN=CG5902 PE=2 SV=1 49 209 1.0E-42
sp|Q8JZZ6|AMERL_MOUSE AMMECR1-like protein OS=Mus musculus GN=Ammecr1l PE=1 SV=1 49 201 5.0E-42
sp|Q5RDQ3|AMERL_PONAB AMMECR1-like protein OS=Pongo abelii GN=AMMECR1L PE=2 SV=1 49 201 6.0E-42
sp|Q6DCA0|AMERL_HUMAN AMMECR1-like protein OS=Homo sapiens GN=AMMECR1L PE=1 SV=1 49 201 6.0E-42
sp|Q9ZVJ2|AMERL_ARATH Uncharacterized protein At2g38710 OS=Arabidopsis thaliana GN=At2g38710 PE=2 SV=1 49 204 7.0E-42
sp|Q22004|AMERL_CAEEL Uncharacterized protein R166.3 OS=Caenorhabditis elegans GN=R166.3 PE=3 SV=1 46 205 1.0E-40
sp|Q5RAS7|AMMR1_PONAB AMME syndrome candidate gene 1 protein homolog OS=Pongo abelii GN=AMMECR1 PE=2 SV=1 49 201 4.0E-40
sp|Q9Y4X0|AMMR1_HUMAN AMME syndrome candidate gene 1 protein OS=Homo sapiens GN=AMMECR1 PE=1 SV=1 49 201 4.0E-40
sp|Q9JHT5|AMMR1_MOUSE AMME syndrome candidate gene 1 protein homolog OS=Mus musculus GN=Ammecr1 PE=2 SV=1 49 201 4.0E-40
sp|Q9P6M2|YKQ3_SCHPO Uncharacterized protein C688.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC688.03c PE=3 SV=2 47 201 5.0E-36
sp|Q12012|YO289_YEAST Uncharacterized protein YOR289W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR289W PE=1 SV=1 48 203 9.0E-35
sp|Q9URS8|Y464_KLULA Uncharacterized protein KLLA0D02464g OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0D02464g PE=3 SV=1 48 202 2.0E-30
sp|Q4JAL7|Y792_SULAC Protein Saci_0792 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0792 PE=3 SV=1 51 192 5.0E-14
sp|Q976G0|Y229_SULTO Protein STK_02290 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_02290 PE=1 SV=1 51 180 4.0E-12
sp|Q5JFK7|Y174_THEKO Protein TK0174 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0174 PE=3 SV=1 50 200 1.0E-09
sp|Q8TY18|Y488_METKA Protein MK0488 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0488 PE=3 SV=1 50 171 2.0E-09
sp|A3DP40|Y1309_STAMF Protein Smar_1309 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=Smar_1309 PE=3 SV=1 9 192 1.0E-08
sp|B6YW91|Y1965_THEON Protein TON_1965 OS=Thermococcus onnurineus (strain NA1) GN=TON_1965 PE=3 SV=1 50 200 1.0E-08
sp|C5A6U0|Y1450_THEGJ Protein TGAM_1450 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=TGAM_1450 PE=3 SV=1 50 200 2.0E-08
sp|O57770|Y010_PYRHO Protein PH0010 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0010 PE=1 SV=1 50 200 4.0E-08
sp|C3NF81|Y855_SULIN Protein YN1551_0855 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=YN1551_0855 PE=3 SV=1 52 191 6.0E-08
sp|C3MJ10|Y2104_SULIL Protein LS215_2104 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=LS215_2104 PE=3 SV=1 52 191 6.0E-08
sp|C3N830|Y2063_SULIY Protein YG5714_2063 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=YG5714_2063 PE=3 SV=1 52 191 6.0E-08
sp|C3MZQ7|Y2019_SULIA Protein M1627_2019 OS=Sulfolobus islandicus (strain M.16.27) GN=M1627_2019 PE=3 SV=1 52 191 6.0E-08
sp|C4KIY8|Y1949_SULIK Protein M164_1949 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=M164_1949 PE=3 SV=1 52 191 6.0E-08
sp|C3MYC8|Y1941_SULIM Protein M1425_1941 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=M1425_1941 PE=3 SV=1 52 191 6.0E-08
sp|O67431|Y1444_AQUAE Protein aq_1444 OS=Aquifex aeolicus (strain VF5) GN=aq_1444 PE=3 SV=1 53 192 9.0E-08
sp|A8MBB6|Y360_CALMQ Protein Cmaq_0360 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=Cmaq_0360 PE=3 SV=1 50 196 2.0E-07
sp|O26945|Y857_METTH Protein MTH_857 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_857 PE=3 SV=1 64 192 2.0E-07
sp|Q8TZL1|Y1979_PYRFU Protein PF1979 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1979 PE=3 SV=1 50 200 2.0E-07
sp|A6UTA8|Y138_META3 Protein Maeo_0138 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=Maeo_0138 PE=3 SV=1 53 171 3.0E-07
sp|Q980T4|Y193_SULSO Protein SSO0193 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0193 PE=3 SV=1 51 191 3.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.7294 0.4685 0.0868 0.0359 0.5287 0.0169 0.1224 0.0905 0.0597 0.0654

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3151
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3779
Ophiocordyceps australis map64 (Brazil) OphauB2|7912
Ophiocordyceps camponoti-floridani Ophcf2|05248
Ophiocordyceps camponoti-rufipedis Ophun1|1986
Ophiocordyceps kimflemingae Ophio5|616
Ophiocordyceps subramaniannii Hirsu2|5548 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5548
LRRVAATDGDGVSSSASSSSASSSSASPALASTPATSTSSLPLGPTSTPLFVTWNTVADDGETSLRGCIGTFEAQ
PLAAGIPEYAVISAVHDSRFAPIAKAELPELQAAVTLLTDFEEADDAYDWELGTHGIRLSFHDRGRRYGSTYLPD
VASEQGWTKDETLFSLIRKSGWVGNRARWKDLDLRVTRYRGKKCSVEYAQYKKWKDWMAANKQ*
Coding >Hirsu2|5548
CTGCGCCGCGTCGCCGCCACCGACGGCGACGGCGTGTCGTCGTCGGCCTCGTCGTCGTCGGCCTCGTCGTCGTCG
GCCTCGCCCGCGCTGGCCTCGACGCCGGCCACGTCGACGTCGTCGCTGCCGCTGGGCCCGACGTCGACGCCGCTC
TTCGTGACGTGGAACACGGTGGCGGACGACGGCGAGACGTCGCTGCGCGGCTGCATCGGCACCTTCGAGGCCCAG
CCGCTGGCCGCGGGCATCCCCGAGTACGCCGTCATCTCGGCTGTGCACGACTCGCGCTTCGCCCCCATCGCCAAG
GCCGAGCTGCCCGAGTTGCAGGCGGCCGTCACGCTGCTGACCGACTTCGAGGAGGCCGACGACGCCTACGACTGG
GAGCTCGGCACCCACGGCATCCGCCTCTCCTTCCACGACCGCGGCCGCCGCTACGGCTCCACCTATCTGCCCGAC
GTGGCCTCGGAGCAGGGCTGGACCAAGGACGAGACGCTCTTCAGCCTGATCCGCAAGTCGGGCTGGGTCGGCAAC
CGGGCGCGCTGGAAGGACCTCGACCTGCGTGTGACGCGCTACCGCGGCAAGAAGTGCAGCGTTGAGTATGCCCAG
TACAAGAAGTGGAAGGACTGGATGGCGGCCAACAAGCAGTGA
Transcript >Hirsu2|5548
CTGCGCCGCGTCGCCGCCACCGACGGCGACGGCGTGTCGTCGTCGGCCTCGTCGTCGTCGGCCTCGTCGTCGTCG
GCCTCGCCCGCGCTGGCCTCGACGCCGGCCACGTCGACGTCGTCGCTGCCGCTGGGCCCGACGTCGACGCCGCTC
TTCGTGACGTGGAACACGGTGGCGGACGACGGCGAGACGTCGCTGCGCGGCTGCATCGGCACCTTCGAGGCCCAG
CCGCTGGCCGCGGGCATCCCCGAGTACGCCGTCATCTCGGCTGTGCACGACTCGCGCTTCGCCCCCATCGCCAAG
GCCGAGCTGCCCGAGTTGCAGGCGGCCGTCACGCTGCTGACCGACTTCGAGGAGGCCGACGACGCCTACGACTGG
GAGCTCGGCACCCACGGCATCCGCCTCTCCTTCCACGACCGCGGCCGCCGCTACGGCTCCACCTATCTGCCCGAC
GTGGCCTCGGAGCAGGGCTGGACCAAGGACGAGACGCTCTTCAGCCTGATCCGCAAGTCGGGCTGGGTCGGCAAC
CGGGCGCGCTGGAAGGACCTCGACCTGCGTGTGACGCGCTACCGCGGCAAGAAGTGCAGCGTTGAGTATGCCCAG
TACAAGAAGTGGAAGGACTGGATGGCGGCCAACAAGCAGTGA
Gene >Hirsu2|5548
CTGCGCCGCGTCGCCGCCACCGACGGCGACGGCGTGTCGTCGTCGGCCTCGTCGTCGTCGGCCTCGTCGTCGTCG
GCCTCGCCCGCGCTGGCCTCGACGCCGGCCACGTCGACGTCGTCGCTGCCGCTGGGCCCGACGTCGACGCCGCTC
TTCGTGACGTGGAACACGGTGGCGGACGACGGCGAGACGTCGCTGCGCGGCTGCATCGGCACCTTCGAGGCCCAG
CCGCTGGCCGCGGGCATCCCCGAGTACGCCGTCATCTCGGCTGTGCACGACTCGCGCTTCGCCCCCATCGCCAAG
GCCGAGCTGCCCGAGTTGCAGGCGGCCGTCACGCTGCTGACCGACTTCGAGGAGGCCGACGACGCCTACGACTGG
GAGCTCGGCACCCACGGCATCCGCCTCTCCTTCCACGACCGCGGCCGCCGCTACGGCTCCACCTATCTGCCCGAC
GTGGCCTCGGAGCAGGGCTGGACCAAGGACGAGACGCTCTTCAGCCTGATCCGCAAGTCGGGCTGGGTCGGCAAC
CGGGCGCGCTGGAAGGACCTCGACCTGCGTGTGACGCGCTACCGCGGCAAGAAGTGCAGCGTTGAGTATGCCCAG
TACAAGAAGTGGAAGGACTGGATGGCGGCCAACAAGCAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail