Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5542
Gene name
LocationContig_278:14663..15366
Strand-
Gene length (bp)703
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01521 Fe-S_biosyn Iron-sulphur cluster biosynthesis 5.4E-19 109 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07821|ISA1_YEAST Iron-sulfur assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISA1 PE=1 SV=1 107 212 8.0E-49
sp|Q5ZJ74|ISCA1_CHICK Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Gallus gallus GN=ISCA1 PE=2 SV=1 96 212 3.0E-41
sp|P0DN75|ISCA1_COLLI Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Columba livia GN=ISCA1 PE=1 SV=1 96 212 1.0E-40
sp|Q9D924|ISCA1_MOUSE Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Mus musculus GN=Isca1 PE=2 SV=1 96 212 3.0E-39
sp|Q80W96|ISCA1_RAT Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Rattus norvegicus GN=Isca1 PE=2 SV=1 96 212 4.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07821|ISA1_YEAST Iron-sulfur assembly protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISA1 PE=1 SV=1 107 212 8.0E-49
sp|Q5ZJ74|ISCA1_CHICK Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Gallus gallus GN=ISCA1 PE=2 SV=1 96 212 3.0E-41
sp|P0DN75|ISCA1_COLLI Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Columba livia GN=ISCA1 PE=1 SV=1 96 212 1.0E-40
sp|Q9D924|ISCA1_MOUSE Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Mus musculus GN=Isca1 PE=2 SV=1 96 212 3.0E-39
sp|Q80W96|ISCA1_RAT Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Rattus norvegicus GN=Isca1 PE=2 SV=1 96 212 4.0E-39
sp|Q4R5F0|ISCA1_MACFA Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Macaca fascicularis GN=ISCA1 PE=2 SV=1 96 212 4.0E-39
sp|Q9BUE6|ISCA1_HUMAN Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Homo sapiens GN=ISCA1 PE=1 SV=1 96 212 4.0E-39
sp|Q3SZG8|ISCA1_BOVIN Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Bos taurus GN=ISCA1 PE=2 SV=1 96 212 4.0E-39
sp|Q8T3X9|ISCA1_DROME Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Drosophila melanogaster GN=l(1)G0136 PE=1 SV=1 94 210 3.0E-38
sp|Q4QRC6|ISCA1_DANRE Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Danio rerio GN=isca1 PE=2 SV=1 87 212 1.0E-36
sp|P78859|ISA1_SCHPO Iron-sulfur assembly protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=isa1 PE=2 SV=1 105 210 1.0E-34
sp|Q8LBM4|ISAM1_ARATH Iron-sulfur assembly protein IscA-like 1, mitochondrial OS=Arabidopsis thaliana GN=At2g16710 PE=2 SV=2 105 211 9.0E-34
sp|Q8L8C0|ISAM3_ARATH Iron-sulfur assembly protein IscA-like 3, mitochondrial OS=Arabidopsis thaliana GN=At2g36260 PE=3 SV=2 105 210 7.0E-29
sp|Q9ZD62|Y484_RICPR Uncharacterized protein RP484 OS=Rickettsia prowazekii (strain Madrid E) GN=RP484 PE=3 SV=1 106 212 1.0E-28
sp|Q54VS1|ISCA1_DICDI Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Dictyostelium discoideum GN=isca1 PE=3 SV=1 104 210 1.0E-25
sp|B4EZU6|ISCA_PROMH Iron-binding protein IscA OS=Proteus mirabilis (strain HI4320) GN=iscA PE=3 SV=1 108 212 3.0E-25
sp|P44672|ISCA_HAEIN Iron-binding protein IscA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=iscA PE=3 SV=1 108 212 3.0E-25
sp|Q8GLE6|ISCA_XENNA Iron-binding protein IscA OS=Xenorhabdus nematophila (strain ATCC 19061 / DSM 3370 / LMG 1036 / NCIB 9965 / AN6) GN=iscA PE=3 SV=1 108 212 1.0E-24
sp|C5BEU3|ISCA_EDWI9 Iron-binding protein IscA OS=Edwardsiella ictaluri (strain 93-146) GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|Q7CQ12|ISCA_SALTY Iron-binding protein IscA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|Q8XFZ8|ISCA_SALTI Iron-binding protein IscA OS=Salmonella typhi GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|B4TRX3|ISCA_SALSV Iron-binding protein IscA OS=Salmonella schwarzengrund (strain CVM19633) GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|B5BAW8|ISCA_SALPK Iron-binding protein IscA OS=Salmonella paratyphi A (strain AKU_12601) GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|C0PYK9|ISCA_SALPC Iron-binding protein IscA OS=Salmonella paratyphi C (strain RKS4594) GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|A9N1X7|ISCA_SALPB Iron-binding protein IscA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|Q5PNG5|ISCA_SALPA Iron-binding protein IscA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|B4TDB4|ISCA_SALHS Iron-binding protein IscA OS=Salmonella heidelberg (strain SL476) GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|B5RD10|ISCA_SALG2 Iron-binding protein IscA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|B5R5A0|ISCA_SALEP Iron-binding protein IscA OS=Salmonella enteritidis PT4 (strain P125109) GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|B5FR83|ISCA_SALDC Iron-binding protein IscA OS=Salmonella dublin (strain CT_02021853) GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|Q57LH1|ISCA_SALCH Iron-binding protein IscA OS=Salmonella choleraesuis (strain SC-B67) GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|A9MHJ6|ISCA_SALAR Iron-binding protein IscA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|B5F1B8|ISCA_SALA4 Iron-binding protein IscA OS=Salmonella agona (strain SL483) GN=iscA PE=3 SV=1 108 212 2.0E-24
sp|B5XNJ9|ISCA_KLEP3 Iron-binding protein IscA OS=Klebsiella pneumoniae (strain 342) GN=iscA PE=3 SV=1 108 212 3.0E-24
sp|A8GHY1|ISCA_SERP5 Iron-binding protein IscA OS=Serratia proteamaculans (strain 568) GN=iscA PE=3 SV=1 108 212 4.0E-24
sp|A1JKQ4|ISCA_YERE8 Iron-binding protein IscA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=iscA PE=3 SV=1 108 212 6.0E-24
sp|A6TCE9|ISCA_KLEP7 Iron-binding protein IscA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=iscA PE=3 SV=1 108 212 6.0E-24
sp|B1JRZ0|ISCA_YERPY Iron-binding protein IscA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=iscA PE=3 SV=1 108 212 7.0E-24
sp|Q667Y3|ISCA_YERPS Iron-binding protein IscA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=iscA PE=3 SV=1 108 212 7.0E-24
sp|A4TMV2|ISCA_YERPP Iron-binding protein IscA OS=Yersinia pestis (strain Pestoides F) GN=iscA PE=3 SV=1 108 212 7.0E-24
sp|Q1CKA7|ISCA_YERPN Iron-binding protein IscA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=iscA PE=3 SV=1 108 212 7.0E-24
sp|A9R816|ISCA_YERPG Iron-binding protein IscA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=iscA PE=3 SV=1 108 212 7.0E-24
sp|Q8ZCS3|ISCA_YERPE Iron-binding protein IscA OS=Yersinia pestis GN=iscA PE=3 SV=1 108 212 7.0E-24
sp|B2K9R5|ISCA_YERPB Iron-binding protein IscA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=iscA PE=3 SV=1 108 212 7.0E-24
sp|Q1C5H2|ISCA_YERPA Iron-binding protein IscA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=iscA PE=3 SV=1 108 212 7.0E-24
sp|A7FFX3|ISCA_YERP3 Iron-binding protein IscA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=iscA PE=3 SV=1 108 212 7.0E-24
sp|A4WDA9|ISCA_ENT38 Iron-binding protein IscA OS=Enterobacter sp. (strain 638) GN=iscA PE=3 SV=1 108 212 9.0E-24
sp|Q6D261|ISCA_PECAS Iron-binding protein IscA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=iscA PE=3 SV=1 108 212 1.0E-23
sp|Q7N226|ISCA_PHOLL Iron-binding protein IscA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=iscA PE=3 SV=1 108 212 1.0E-23
sp|B4T0S0|ISCA_SALNS Iron-binding protein IscA OS=Salmonella newport (strain SL254) GN=iscA PE=3 SV=1 108 212 3.0E-23
sp|Q3YZ24|ISCA_SHISS Iron-binding protein IscA OS=Shigella sonnei (strain Ss046) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|P0AAD1|ISCA_SHIFL Iron-binding protein IscA OS=Shigella flexneri GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|Q32D36|ISCA_SHIDS Iron-binding protein IscA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|Q31XW2|ISCA_SHIBS Iron-binding protein IscA OS=Shigella boydii serotype 4 (strain Sb227) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|B7LKB1|ISCA_ESCF3 Iron-binding protein IscA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|B1LNI4|ISCA_ECOSM Iron-binding protein IscA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|B6I5A0|ISCA_ECOSE Iron-binding protein IscA OS=Escherichia coli (strain SE11) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|B7N6B5|ISCA_ECOLU Iron-binding protein IscA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|P0AAC8|ISCA_ECOLI Iron-binding protein IscA OS=Escherichia coli (strain K12) GN=iscA PE=1 SV=1 108 212 8.0E-23
sp|B1IWD3|ISCA_ECOLC Iron-binding protein IscA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|P0AAC9|ISCA_ECOL6 Iron-binding protein IscA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|Q0TEV7|ISCA_ECOL5 Iron-binding protein IscA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|A1AE65|ISCA_ECOK1 Iron-binding protein IscA OS=Escherichia coli O1:K1 / APEC GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|B1XB03|ISCA_ECODH Iron-binding protein IscA OS=Escherichia coli (strain K12 / DH10B) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|C4ZXA3|ISCA_ECOBW Iron-binding protein IscA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|B7M7N1|ISCA_ECO8A Iron-binding protein IscA OS=Escherichia coli O8 (strain IAI1) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|B7MYG2|ISCA_ECO81 Iron-binding protein IscA OS=Escherichia coli O81 (strain ED1a) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|B7NRH7|ISCA_ECO7I Iron-binding protein IscA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|P0AAD0|ISCA_ECO57 Iron-binding protein IscA OS=Escherichia coli O157:H7 GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|B7LDC0|ISCA_ECO55 Iron-binding protein IscA OS=Escherichia coli (strain 55989 / EAEC) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|B7MIL8|ISCA_ECO45 Iron-binding protein IscA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|B7UGX4|ISCA_ECO27 Iron-binding protein IscA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=iscA PE=3 SV=1 108 212 8.0E-23
sp|C6DBI9|ISCA_PECCP Iron-binding protein IscA OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=iscA PE=3 SV=1 108 212 2.0E-22
sp|A7MGY0|ISCA_CROS8 Iron-binding protein IscA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=iscA PE=3 SV=1 131 212 5.0E-22
sp|C5BAP7|ERPA_EDWI9 Iron-sulfur cluster insertion protein ErpA OS=Edwardsiella ictaluri (strain 93-146) GN=erpA PE=3 SV=1 109 212 3.0E-18
sp|B2UFK5|ERPA_RALPJ Putative iron-sulfur cluster insertion protein ErpA OS=Ralstonia pickettii (strain 12J) GN=erpA PE=3 SV=1 95 212 5.0E-18
sp|B8CQR0|ERPA_SHEPW Iron-sulfur cluster insertion protein ErpA OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=erpA PE=3 SV=1 109 212 6.0E-18
sp|P77667|SUFA_ECOLI Protein SufA OS=Escherichia coli (strain K12) GN=sufA PE=1 SV=1 108 212 7.0E-18
sp|B0TIR0|ERPA_SHEHH Iron-sulfur cluster insertion protein ErpA OS=Shewanella halifaxensis (strain HAW-EB4) GN=erpA PE=3 SV=1 109 212 7.0E-18
sp|Q8Y242|ERPA_RALSO Putative iron-sulfur cluster insertion protein ErpA OS=Ralstonia solanacearum (strain GMI1000) GN=erpA PE=3 SV=1 95 212 8.0E-18
sp|A8H175|ERPA_SHEPA Iron-sulfur cluster insertion protein ErpA OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=erpA PE=3 SV=1 109 212 8.0E-18
sp|B2VE26|ERPA_ERWT9 Iron-sulfur cluster insertion protein ErpA OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|Q9I5Q6|ERPA_PSEAE Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|Q02TA1|ERPA_PSEAB Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|B7V623|ERPA_PSEA8 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas aeruginosa (strain LESB58) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|A6UZG6|ERPA_PSEA7 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas aeruginosa (strain PA7) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|A1WL78|ERPA_VEREI Putative iron-sulfur cluster insertion protein ErpA OS=Verminephrobacter eiseniae (strain EF01-2) GN=erpA PE=3 SV=1 87 210 1.0E-17
sp|Q12KD2|ERPA_SHEDO Iron-sulfur cluster insertion protein ErpA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|A8G9U9|ERPA_SERP5 Iron-sulfur cluster insertion protein ErpA OS=Serratia proteamaculans (strain 568) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|Q7CR66|ERPA_SALTY Iron-sulfur cluster insertion protein ErpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=erpA PE=3 SV=2 109 212 1.0E-17
sp|Q8XFF3|ERPA_SALTI Iron-sulfur cluster insertion protein ErpA OS=Salmonella typhi GN=erpA PE=3 SV=2 109 212 1.0E-17
sp|B4TXQ8|ERPA_SALSV Iron-sulfur cluster insertion protein ErpA OS=Salmonella schwarzengrund (strain CVM19633) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|A9N0Q2|ERPA_SALPB Iron-sulfur cluster insertion protein ErpA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|Q5PD49|ERPA_SALPA Iron-sulfur cluster insertion protein ErpA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=erpA PE=3 SV=2 109 212 1.0E-17
sp|B4SUY6|ERPA_SALNS Iron-sulfur cluster insertion protein ErpA OS=Salmonella newport (strain SL254) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|B4TK32|ERPA_SALHS Iron-sulfur cluster insertion protein ErpA OS=Salmonella heidelberg (strain SL476) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|B5RHE2|ERPA_SALG2 Iron-sulfur cluster insertion protein ErpA OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|B5R3G8|ERPA_SALEP Iron-sulfur cluster insertion protein ErpA OS=Salmonella enteritidis PT4 (strain P125109) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|B5FJ03|ERPA_SALDC Iron-sulfur cluster insertion protein ErpA OS=Salmonella dublin (strain CT_02021853) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|Q57T51|ERPA_SALCH Iron-sulfur cluster insertion protein ErpA OS=Salmonella choleraesuis (strain SC-B67) GN=erpA PE=3 SV=2 109 212 1.0E-17
sp|A9MPK5|ERPA_SALAR Iron-sulfur cluster insertion protein ErpA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|B5F8R7|ERPA_SALA4 Iron-sulfur cluster insertion protein ErpA OS=Salmonella agona (strain SL483) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|A4XZB1|ERPA_PSEMY Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas mendocina (strain ymp) GN=erpA PE=3 SV=1 109 212 1.0E-17
sp|A4JBK6|ERPA1_BURVG Putative iron-sulfur cluster insertion protein ErpA 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=erpA1 PE=3 SV=1 111 212 1.0E-17
sp|Q2NVP9|ERPA_SODGM Iron-sulfur cluster insertion protein ErpA OS=Sodalis glossinidius (strain morsitans) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|Q3Z5K1|ERPA_SHISS Iron-sulfur cluster insertion protein ErpA OS=Shigella sonnei (strain Ss046) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|P0ACC6|ERPA_SHIFL Iron-sulfur cluster insertion protein ErpA OS=Shigella flexneri GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|Q0T850|ERPA_SHIF8 Iron-sulfur cluster insertion protein ErpA OS=Shigella flexneri serotype 5b (strain 8401) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|Q32JV2|ERPA_SHIDS Iron-sulfur cluster insertion protein ErpA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|Q325Y3|ERPA_SHIBS Iron-sulfur cluster insertion protein ErpA OS=Shigella boydii serotype 4 (strain Sb227) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|B2U301|ERPA_SHIB3 Iron-sulfur cluster insertion protein ErpA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|B7LWB7|ERPA_ESCF3 Iron-sulfur cluster insertion protein ErpA OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|Q1RG32|ERPA_ECOUT Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain UTI89 / UPEC) GN=erpA PE=3 SV=2 109 212 2.0E-17
sp|B1LGV9|ERPA_ECOSM Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|B6HZD2|ERPA_ECOSE Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain SE11) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|B7N825|ERPA_ECOLU Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|P0ACC3|ERPA_ECOLI Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain K12) GN=erpA PE=1 SV=1 109 212 2.0E-17
sp|B1IQI4|ERPA_ECOLC Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|P0ACC4|ERPA_ECOL6 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|Q0TLH5|ERPA_ECOL5 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|A1A7K2|ERPA_ECOK1 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O1:K1 / APEC GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|A7ZWA4|ERPA_ECOHS Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O9:H4 (strain HS) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|B1XD26|ERPA_ECODH Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain K12 / DH10B) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|C4ZRP9|ERPA_ECOBW Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|B7M197|ERPA_ECO8A Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O8 (strain IAI1) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|B7MP18|ERPA_ECO81 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O81 (strain ED1a) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|B7NIB9|ERPA_ECO7I Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|B5Z0D6|ERPA_ECO5E Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|P0ACC5|ERPA_ECO57 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O157:H7 GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|B7LGL8|ERPA_ECO55 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli (strain 55989 / EAEC) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|B7MBD9|ERPA_ECO45 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|B7UIK3|ERPA_ECO27 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|A7ZHP8|ERPA_ECO24 Iron-sulfur cluster insertion protein ErpA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=erpA PE=3 SV=1 109 212 2.0E-17
sp|A9AH79|ERPA_BURM1 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=erpA PE=3 SV=1 111 212 2.0E-17
sp|Q39JJ8|ERPA_BURL3 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=erpA PE=3 SV=1 111 212 2.0E-17
sp|Q0BI89|ERPA_BURCM Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=erpA PE=3 SV=1 111 212 2.0E-17
sp|B1YTD3|ERPA_BURA4 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia ambifaria (strain MC40-6) GN=erpA PE=3 SV=1 111 212 2.0E-17
sp|A1W3Q0|ERPA_ACISJ Putative iron-sulfur cluster insertion protein ErpA OS=Acidovorax sp. (strain JS42) GN=erpA PE=3 SV=1 87 212 3.0E-17
sp|A8ALD2|ERPA_CITK8 Iron-sulfur cluster insertion protein ErpA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=erpA PE=3 SV=1 109 212 3.0E-17
sp|Q9XIK3|ISCAP_ARATH Iron-sulfur assembly protein IscA, chloroplastic OS=Arabidopsis thaliana GN=ISCA PE=2 SV=2 100 210 3.0E-17
sp|Q6D1Z1|ERPA_PECAS Iron-sulfur cluster insertion protein ErpA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=erpA PE=3 SV=1 109 212 3.0E-17
sp|B1JK20|ERPA_YERPY Iron-sulfur cluster insertion protein ErpA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=erpA PE=3 SV=1 109 212 3.0E-17
sp|Q66EE9|ERPA_YERPS Iron-sulfur cluster insertion protein ErpA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=erpA PE=3 SV=1 109 212 3.0E-17
sp|A4TPW8|ERPA_YERPP Iron-sulfur cluster insertion protein ErpA OS=Yersinia pestis (strain Pestoides F) GN=erpA PE=3 SV=1 109 212 3.0E-17
sp|Q1CLU5|ERPA_YERPN Iron-sulfur cluster insertion protein ErpA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=erpA PE=3 SV=1 109 212 3.0E-17
sp|A9R1E3|ERPA_YERPG Iron-sulfur cluster insertion protein ErpA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=erpA PE=3 SV=1 109 212 3.0E-17
sp|Q0WBQ9|ERPA_YERPE Iron-sulfur cluster insertion protein ErpA OS=Yersinia pestis GN=erpA PE=3 SV=1 109 212 3.0E-17
sp|B2K550|ERPA_YERPB Iron-sulfur cluster insertion protein ErpA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=erpA PE=3 SV=1 109 212 3.0E-17
sp|Q1C3X3|ERPA_YERPA Iron-sulfur cluster insertion protein ErpA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=erpA PE=3 SV=1 109 212 3.0E-17
sp|A7FM07|ERPA_YERP3 Iron-sulfur cluster insertion protein ErpA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=erpA PE=3 SV=1 109 212 3.0E-17
sp|A3QBP0|ERPA_SHELP Iron-sulfur cluster insertion protein ErpA OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=erpA PE=3 SV=1 109 212 3.0E-17
sp|A6T4W0|ERPA_KLEP7 Iron-sulfur cluster insertion protein ErpA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=erpA PE=3 SV=1 109 212 4.0E-17
sp|A4T031|ERPA_POLSQ Putative iron-sulfur cluster insertion protein ErpA OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=erpA PE=3 SV=1 98 210 5.0E-17
sp|B5Y1L3|ERPA_KLEP3 Iron-sulfur cluster insertion protein ErpA OS=Klebsiella pneumoniae (strain 342) GN=erpA PE=3 SV=1 109 212 6.0E-17
sp|A6VN49|ERPA_ACTSZ Iron-sulfur cluster insertion protein ErpA OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=erpA PE=3 SV=1 109 212 6.0E-17
sp|A1JJQ3|ERPA_YERE8 Iron-sulfur cluster insertion protein ErpA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=erpA PE=3 SV=1 109 212 6.0E-17
sp|Q0HSF0|ERPA_SHESR Iron-sulfur cluster insertion protein ErpA OS=Shewanella sp. (strain MR-7) GN=erpA PE=3 SV=1 109 212 6.0E-17
sp|Q0HG57|ERPA_SHESM Iron-sulfur cluster insertion protein ErpA OS=Shewanella sp. (strain MR-4) GN=erpA PE=3 SV=1 109 212 6.0E-17
sp|A0KZS2|ERPA_SHESA Iron-sulfur cluster insertion protein ErpA OS=Shewanella sp. (strain ANA-3) GN=erpA PE=3 SV=1 109 212 6.0E-17
sp|Q8EHC4|ERPA_SHEON Iron-sulfur cluster insertion protein ErpA OS=Shewanella oneidensis (strain MR-1) GN=erpA PE=3 SV=2 109 212 6.0E-17
sp|Q220S8|ERPA_RHOFT Putative iron-sulfur cluster insertion protein ErpA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=erpA PE=3 SV=1 87 210 7.0E-17
sp|Q31IS8|ERPA_THICR Iron-sulfur cluster insertion protein ErpA OS=Thiomicrospira crunogena (strain XCL-2) GN=erpA PE=3 SV=1 109 212 7.0E-17
sp|B4EET4|ERPA_BURCJ Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=erpA PE=3 SV=1 111 212 8.0E-17
sp|A0K4K7|ERPA_BURCH Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia cenocepacia (strain HI2424) GN=erpA PE=3 SV=1 111 212 8.0E-17
sp|B1JVU6|ERPA_BURCC Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia cenocepacia (strain MC0-3) GN=erpA PE=3 SV=1 111 212 8.0E-17
sp|Q1BZ43|ERPA_BURCA Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia cenocepacia (strain AU 1054) GN=erpA PE=3 SV=1 111 212 8.0E-17
sp|P72731|Y1417_SYNY3 Uncharacterized protein slr1417 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1417 PE=3 SV=1 108 212 9.0E-17
sp|A4W6Q3|ERPA_ENT38 Iron-sulfur cluster insertion protein ErpA OS=Enterobacter sp. (strain 638) GN=erpA PE=3 SV=1 109 212 9.0E-17
sp|A6SUP2|ERPA_JANMA Putative iron-sulfur cluster insertion protein ErpA OS=Janthinobacterium sp. (strain Marseille) GN=erpA PE=3 SV=1 95 210 1.0E-16
sp|A1TUF2|ERPA_ACIAC Putative iron-sulfur cluster insertion protein ErpA OS=Acidovorax citrulli (strain AAC00-1) GN=erpA PE=3 SV=1 87 212 1.0E-16
sp|Q1QSB5|ERPA_CHRSD Iron-sulfur cluster insertion protein ErpA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=erpA PE=3 SV=1 109 212 1.0E-16
sp|Q65SZ6|ERPA_MANSM Iron-sulfur cluster insertion protein ErpA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=erpA PE=3 SV=1 109 212 1.0E-16
sp|A0KNY6|ERPA_AERHH Iron-sulfur cluster insertion protein ErpA OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=erpA PE=3 SV=2 109 212 2.0E-16
sp|A7MGR3|ERPA_CROS8 Iron-sulfur cluster insertion protein ErpA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=erpA PE=3 SV=1 109 212 2.0E-16
sp|A1RMG3|ERPA_SHESW Iron-sulfur cluster insertion protein ErpA OS=Shewanella sp. (strain W3-18-1) GN=erpA PE=3 SV=1 109 212 2.0E-16
sp|A4Y4G8|ERPA_SHEPC Iron-sulfur cluster insertion protein ErpA OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=erpA PE=3 SV=1 109 212 2.0E-16
sp|B4EUE2|ERPA_PROMH Iron-sulfur cluster insertion protein ErpA OS=Proteus mirabilis (strain HI4320) GN=erpA PE=3 SV=1 109 212 2.0E-16
sp|Q8PD57|ERPA_XANCP Iron-sulfur cluster insertion protein ErpA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=erpA PE=3 SV=1 96 212 2.0E-16
sp|B0RN15|ERPA_XANCB Iron-sulfur cluster insertion protein ErpA OS=Xanthomonas campestris pv. campestris (strain B100) GN=erpA PE=3 SV=1 96 212 2.0E-16
sp|Q4UZE2|ERPA_XANC8 Iron-sulfur cluster insertion protein ErpA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=erpA PE=3 SV=1 96 212 2.0E-16
sp|Q7N843|ERPA_PHOLL Iron-sulfur cluster insertion protein ErpA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=erpA PE=3 SV=1 109 212 2.0E-16
sp|Q4ZMM4|ERPA_PSEU2 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=erpA PE=3 SV=1 107 212 2.0E-16
sp|Q889Z2|ERPA_PSESM Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=erpA PE=3 SV=1 107 212 2.0E-16
sp|Q48NN6|ERPA_PSE14 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=erpA PE=3 SV=1 107 212 2.0E-16
sp|Q07YU9|ERPA_SHEFN Iron-sulfur cluster insertion protein ErpA OS=Shewanella frigidimarina (strain NCIMB 400) GN=erpA PE=3 SV=1 109 212 3.0E-16
sp|B0U4D9|ERPA_XYLFM Iron-sulfur cluster insertion protein ErpA OS=Xylella fastidiosa (strain M12) GN=erpA PE=3 SV=1 100 212 3.0E-16
sp|P64343|ERPA_XYLFT Iron-sulfur cluster insertion protein ErpA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=erpA PE=3 SV=1 100 212 3.0E-16
sp|P64342|ERPA_XYLFA Iron-sulfur cluster insertion protein ErpA OS=Xylella fastidiosa (strain 9a5c) GN=erpA PE=3 SV=1 100 212 3.0E-16
sp|B2I891|ERPA_XYLF2 Iron-sulfur cluster insertion protein ErpA OS=Xylella fastidiosa (strain M23) GN=erpA PE=3 SV=1 100 212 3.0E-16
sp|B2AH60|ERPA_CUPTR Putative iron-sulfur cluster insertion protein ErpA OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=erpA PE=3 SV=1 111 212 3.0E-16
sp|Q475T0|ERPA_CUPPJ Putative iron-sulfur cluster insertion protein ErpA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=erpA PE=3 SV=1 111 212 3.0E-16
sp|Q0KED6|ERPA_CUPNH Putative iron-sulfur cluster insertion protein ErpA OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=erpA PE=3 SV=1 111 212 3.0E-16
sp|B0UU19|ERPA_HISS2 Iron-sulfur cluster insertion protein ErpA OS=Histophilus somni (strain 2336) GN=erpA PE=3 SV=1 109 212 3.0E-16
sp|B2JGV0|ERPA_BURP8 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=erpA PE=3 SV=1 111 212 3.0E-16
sp|Q0I3N9|ERPA_HAES1 Iron-sulfur cluster insertion protein ErpA OS=Haemophilus somnus (strain 129Pt) GN=erpA PE=3 SV=1 109 212 3.0E-16
sp|Q1LRC6|ERPA_CUPMC Putative iron-sulfur cluster insertion protein ErpA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=erpA PE=3 SV=1 111 212 3.0E-16
sp|B2FJT4|ERPA_STRMK Iron-sulfur cluster insertion protein ErpA OS=Stenotrophomonas maltophilia (strain K279a) GN=erpA PE=3 SV=1 89 210 3.0E-16
sp|Q3SF18|ERPA_THIDA Putative iron-sulfur cluster insertion protein ErpA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=erpA PE=3 SV=1 109 210 4.0E-16
sp|Q2SZ67|ERPA_BURTA Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=erpA PE=3 SV=1 111 212 4.0E-16
sp|Q63QW5|ERPA_BURPS Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia pseudomallei (strain K96243) GN=erpA PE=3 SV=1 111 212 4.0E-16
sp|A3NDG6|ERPA_BURP6 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia pseudomallei (strain 668) GN=erpA PE=3 SV=1 111 212 4.0E-16
sp|Q3JNR3|ERPA_BURP1 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia pseudomallei (strain 1710b) GN=erpA PE=3 SV=1 111 212 4.0E-16
sp|A3NZ78|ERPA_BURP0 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia pseudomallei (strain 1106a) GN=erpA PE=3 SV=1 111 212 4.0E-16
sp|A1V053|ERPA_BURMS Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia mallei (strain SAVP1) GN=erpA PE=3 SV=1 111 212 4.0E-16
sp|Q62HB8|ERPA_BURMA Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia mallei (strain ATCC 23344) GN=erpA PE=3 SV=1 111 212 4.0E-16
sp|A2S583|ERPA_BURM9 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia mallei (strain NCTC 10229) GN=erpA PE=3 SV=1 111 212 4.0E-16
sp|A3MP61|ERPA_BURM7 Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia mallei (strain NCTC 10247) GN=erpA PE=3 SV=1 111 212 4.0E-16
sp|A2SKL7|ERPA_METPP Putative iron-sulfur cluster insertion protein ErpA OS=Methylibium petroleiphilum (strain PM1) GN=erpA PE=3 SV=1 111 210 4.0E-16
sp|A1TYH3|ERPA_MARHV Iron-sulfur cluster insertion protein ErpA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=erpA PE=3 SV=1 109 212 4.0E-16
sp|Q8PQ32|ERPA_XANAC Iron-sulfur cluster insertion protein ErpA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=erpA PE=3 SV=1 96 212 4.0E-16
sp|A4G1T7|ERPA_HERAR Putative iron-sulfur cluster insertion protein ErpA OS=Herminiimonas arsenicoxydans GN=erpA PE=3 SV=1 95 210 4.0E-16
sp|Q1GXC7|ERPA_METFK Putative iron-sulfur cluster insertion protein ErpA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=erpA PE=3 SV=1 109 210 7.0E-16
sp|Q5H5J1|ERPA_XANOR Iron-sulfur cluster insertion protein ErpA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=erpA PE=3 SV=2 96 212 7.0E-16
sp|Q2P884|ERPA_XANOM Iron-sulfur cluster insertion protein ErpA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=erpA PE=3 SV=1 96 212 7.0E-16
sp|Q4K514|ERPA_PSEF5 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=erpA PE=3 SV=1 107 212 8.0E-16
sp|A5CVH1|ERPA_VESOH Iron-sulfur cluster insertion protein ErpA OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=erpA PE=3 SV=1 104 212 8.0E-16
sp|A4SJ82|ERPA_AERS4 Iron-sulfur cluster insertion protein ErpA OS=Aeromonas salmonicida (strain A449) GN=erpA PE=3 SV=1 109 212 9.0E-16
sp|Q3BY98|ERPA_XANC5 Iron-sulfur cluster insertion protein ErpA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=erpA PE=3 SV=1 98 212 9.0E-16
sp|B4SLD1|ERPA_STRM5 Iron-sulfur cluster insertion protein ErpA OS=Stenotrophomonas maltophilia (strain R551-3) GN=erpA PE=3 SV=1 89 210 9.0E-16
sp|Q9CNH3|ERPA_PASMU Iron-sulfur cluster insertion protein ErpA OS=Pasteurella multocida (strain Pm70) GN=erpA PE=3 SV=1 109 212 1.0E-15
sp|Q1IFY7|ERPA_PSEE4 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas entomophila (strain L48) GN=erpA PE=3 SV=1 108 212 1.0E-15
sp|A1AXV9|ERPA_RUTMC Iron-sulfur cluster insertion protein ErpA OS=Ruthia magnifica subsp. Calyptogena magnifica GN=erpA PE=3 SV=1 105 212 1.0E-15
sp|A9L5J9|ERPA_SHEB9 Iron-sulfur cluster insertion protein ErpA OS=Shewanella baltica (strain OS195) GN=erpA PE=3 SV=1 109 212 1.0E-15
sp|A6WKM0|ERPA_SHEB8 Iron-sulfur cluster insertion protein ErpA OS=Shewanella baltica (strain OS185) GN=erpA PE=3 SV=1 109 212 1.0E-15
sp|A3D1R9|ERPA_SHEB5 Iron-sulfur cluster insertion protein ErpA OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=erpA PE=3 SV=1 109 212 1.0E-15
sp|B8EBT9|ERPA_SHEB2 Iron-sulfur cluster insertion protein ErpA OS=Shewanella baltica (strain OS223) GN=erpA PE=3 SV=1 109 212 1.0E-15
sp|A5UFF5|ERPA_HAEIG Iron-sulfur cluster insertion protein ErpA OS=Haemophilus influenzae (strain PittGG) GN=erpA PE=3 SV=1 109 212 1.0E-15
sp|Q4QJM4|ERPA_HAEI8 Iron-sulfur cluster insertion protein ErpA OS=Haemophilus influenzae (strain 86-028NP) GN=erpA PE=3 SV=1 109 212 1.0E-15
sp|Q9MSA1|YCF83_GALSU Uncharacterized protein ycf83 OS=Galdieria sulphuraria GN=ycf83 PE=3 SV=1 109 210 2.0E-15
sp|Q124P0|ERPA_POLSJ Putative iron-sulfur cluster insertion protein ErpA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=erpA PE=3 SV=1 87 210 2.0E-15
sp|Q15YG5|ERPA_PSEA6 Iron-sulfur cluster insertion protein ErpA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=erpA PE=3 SV=1 109 212 2.0E-15
sp|P45344|ERPA_HAEIN Iron-sulfur cluster insertion protein ErpA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=erpA PE=1 SV=1 109 212 2.0E-15
sp|A5UBF7|ERPA_HAEIE Iron-sulfur cluster insertion protein ErpA OS=Haemophilus influenzae (strain PittEE) GN=erpA PE=3 SV=1 109 212 2.0E-15
sp|C1DHX9|ERPA_AZOVD Iron-sulfur cluster insertion protein ErpA OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=erpA PE=3 SV=1 109 212 2.0E-15
sp|Q9X4A0|ERPA_HAEDU Iron-sulfur cluster insertion protein ErpA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=erpA PE=3 SV=1 109 212 2.0E-15
sp|Q1LTN5|ERPA_BAUCH Iron-sulfur cluster insertion protein ErpA OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=erpA PE=3 SV=1 109 210 2.0E-15
sp|Q82UQ4|ERPA_NITEU Putative iron-sulfur cluster insertion protein ErpA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=erpA PE=3 SV=1 109 212 2.0E-15
sp|A9I246|ERPA_BORPD Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=erpA PE=3 SV=1 94 212 3.0E-15
sp|A4VHK9|ERPA_PSEU5 Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas stutzeri (strain A1501) GN=erpA PE=3 SV=1 108 212 3.0E-15
sp|B5FAL7|ERPA_VIBFM Iron-sulfur cluster insertion protein ErpA OS=Vibrio fischeri (strain MJ11) GN=erpA PE=3 SV=1 109 212 4.0E-15
sp|Q5E2W7|ERPA_VIBF1 Iron-sulfur cluster insertion protein ErpA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=erpA PE=3 SV=1 109 212 4.0E-15
sp|Q3K5W6|ERPA_PSEPF Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas fluorescens (strain Pf0-1) GN=erpA PE=3 SV=1 107 212 4.0E-15
sp|Q47VA3|ERPA_COLP3 Iron-sulfur cluster insertion protein ErpA OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=erpA PE=3 SV=1 109 212 4.0E-15
sp|B2SYK8|ERPA_BURPP Putative iron-sulfur cluster insertion protein ErpA OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=erpA PE=3 SV=1 111 212 5.0E-15
sp|Q13UB4|ERPA1_BURXL Putative iron-sulfur cluster insertion protein ErpA 1 OS=Burkholderia xenovorans (strain LB400) GN=erpA1 PE=3 SV=1 111 212 5.0E-15
sp|B4RWS2|ERPA_ALTMD Iron-sulfur cluster insertion protein ErpA OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=erpA PE=3 SV=2 109 212 5.0E-15
sp|Q2KV08|ERPA_BORA1 Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella avium (strain 197N) GN=erpA PE=3 SV=1 109 212 5.0E-15
sp|C3K2Z6|ERPA_PSEFS Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas fluorescens (strain SBW25) GN=erpA PE=3 SV=1 107 212 5.0E-15
sp|O32113|SUFA_BACSU Uncharacterized protein SufA OS=Bacillus subtilis (strain 168) GN=sufA PE=3 SV=1 109 210 7.0E-15
sp|A1WVE3|ERPA_HALHL Iron-sulfur cluster insertion protein ErpA OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=erpA PE=3 SV=1 96 212 7.0E-15
sp|A4JRL3|ERPA2_BURVG Putative iron-sulfur cluster insertion protein ErpA 2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=erpA2 PE=3 SV=1 107 212 8.0E-15
sp|A9C177|ERPA_DELAS Putative iron-sulfur cluster insertion protein ErpA OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=erpA PE=3 SV=1 111 212 8.0E-15
sp|Q60AU6|ERPA2_METCA Iron-sulfur cluster insertion protein ErpA 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=erpA2 PE=3 SV=1 108 212 1.0E-14
sp|Q6LUS1|ERPA_PHOPR Iron-sulfur cluster insertion protein ErpA OS=Photobacterium profundum GN=erpA PE=3 SV=1 109 212 1.0E-14
sp|Q2S8Y5|ERPA_HAHCH Iron-sulfur cluster insertion protein ErpA OS=Hahella chejuensis (strain KCTC 2396) GN=erpA PE=3 SV=1 109 212 1.0E-14
sp|Q7VUW2|ERPA_BORPE Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=erpA PE=3 SV=1 109 212 1.0E-14
sp|Q7W3Z5|ERPA_BORPA Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=erpA PE=3 SV=1 109 212 1.0E-14
sp|Q7WFC7|ERPA_BORBR Putative iron-sulfur cluster insertion protein ErpA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=erpA PE=3 SV=1 109 212 1.0E-14
sp|Q47887|YNIU_FRAAL Uncharacterized protein in nifB-nifU intergenic region OS=Frankia alni PE=3 SV=1 102 210 1.0E-14
sp|O67709|Y1857_AQUAE Protein aq_1857 OS=Aquifex aeolicus (strain VF5) GN=aq_1857 PE=1 SV=1 103 210 2.0E-14
sp|A1K969|ERPA_AZOSB Putative iron-sulfur cluster insertion protein ErpA OS=Azoarcus sp. (strain BH72) GN=erpA PE=3 SV=1 109 210 2.0E-14
sp|A3N2B0|ERPA_ACTP2 Iron-sulfur cluster insertion protein ErpA OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=erpA PE=3 SV=1 109 212 2.0E-14
sp|Q5P7U0|ERPA_AROAE Putative iron-sulfur cluster insertion protein ErpA OS=Aromatoleum aromaticum (strain EbN1) GN=erpA PE=3 SV=1 109 210 2.0E-14
sp|Q0ABJ8|ERPA_ALKEH Iron-sulfur cluster insertion protein ErpA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=erpA PE=3 SV=1 108 212 2.0E-14
sp|B5EQH0|ERPA_ACIF5 Iron-sulfur cluster insertion protein ErpA OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=erpA PE=3 SV=1 108 210 2.0E-14
sp|B7JAH6|ERPA_ACIF2 Iron-sulfur cluster insertion protein ErpA OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=erpA PE=3 SV=1 108 210 2.0E-14
sp|B8F870|ERPA_HAEPS Iron-sulfur cluster insertion protein ErpA OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=erpA PE=3 SV=1 109 212 3.0E-14
sp|Q3IHQ0|ERPA_PSEHT Iron-sulfur cluster insertion protein ErpA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=erpA PE=3 SV=1 109 212 3.0E-14
sp|B3H296|ERPA_ACTP7 Iron-sulfur cluster insertion protein ErpA OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=erpA PE=3 SV=1 109 212 3.0E-14
sp|B0BR51|ERPA_ACTPJ Iron-sulfur cluster insertion protein ErpA OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=erpA PE=3 SV=1 109 212 3.0E-14
sp|P74596|Y1565_SYNY3 Uncharacterized protein slr1565 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1565 PE=1 SV=1 109 210 4.0E-14
sp|Q0AFU6|ERPA_NITEC Putative iron-sulfur cluster insertion protein ErpA OS=Nitrosomonas eutropha (strain C91) GN=erpA PE=3 SV=1 109 212 5.0E-14
sp|Q21MI1|ERPA_SACD2 Iron-sulfur cluster insertion protein ErpA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=erpA PE=3 SV=1 109 212 5.0E-14
sp|Q0VSN8|ERPA_ALCBS Iron-sulfur cluster insertion protein ErpA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=erpA PE=3 SV=2 109 212 6.0E-14
sp|Q88QQ5|ERPA_PSEPK Iron-sulfur cluster insertion protein ErpA OS=Pseudomonas putida (strain KT2440) GN=erpA PE=3 SV=2 107 212 6.0E-14
sp|B0VAE9|ERPA_ACIBY Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain AYE) GN=erpA PE=3 SV=1 108 212 6.0E-14
sp|A3M0R4|ERPA_ACIBT Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=erpA PE=3 SV=2 108 212 6.0E-14
sp|B2I2I7|ERPA_ACIBC Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain ACICU) GN=erpA PE=3 SV=1 108 212 6.0E-14
sp|B7IAZ8|ERPA_ACIB5 Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain AB0057) GN=erpA PE=3 SV=1 108 212 6.0E-14
sp|B7GUY5|ERPA_ACIB3 Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain AB307-0294) GN=erpA PE=3 SV=1 108 212 6.0E-14
sp|Q7MHZ0|ERPA_VIBVY Iron-sulfur cluster insertion protein ErpA OS=Vibrio vulnificus (strain YJ016) GN=erpA PE=3 SV=2 109 212 8.0E-14
sp|Q7NRT6|ERPA_CHRVO Putative iron-sulfur cluster insertion protein ErpA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=erpA PE=3 SV=1 109 212 8.0E-14
sp|Q47IC1|ERPA_DECAR Putative iron-sulfur cluster insertion protein ErpA OS=Dechloromonas aromatica (strain RCB) GN=erpA PE=3 SV=1 111 210 8.0E-14
sp|Q6FG12|ERPA_ACIAD Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=erpA PE=3 SV=1 108 212 8.0E-14
sp|Q8DBX7|ERPA_VIBVU Iron-sulfur cluster insertion protein ErpA OS=Vibrio vulnificus (strain CMCP6) GN=erpA PE=3 SV=3 109 212 8.0E-14
sp|Q87LY4|ERPA_VIBPA Iron-sulfur cluster insertion protein ErpA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=erpA PE=3 SV=1 109 212 8.0E-14
sp|B0VML0|ERPA_ACIBS Iron-sulfur cluster insertion protein ErpA OS=Acinetobacter baumannii (strain SDF) GN=erpA PE=3 SV=1 108 212 1.0E-13
sp|B6EL03|ERPA_ALISL Iron-sulfur cluster insertion protein ErpA OS=Aliivibrio salmonicida (strain LFI1238) GN=erpA PE=3 SV=1 109 212 1.0E-13
sp|A1VMK3|ERPA2_POLNA Putative iron-sulfur cluster insertion protein ErpA 2 OS=Polaromonas naphthalenivorans (strain CJ2) GN=erpA2 PE=3 SV=1 112 212 1.0E-13
sp|Q13N17|ERPA2_BURXL Putative iron-sulfur cluster insertion protein ErpA 2 OS=Burkholderia xenovorans (strain LB400) GN=erpA2 PE=3 SV=1 87 212 1.0E-13
sp|Q2YBK7|ERPA_NITMU Putative iron-sulfur cluster insertion protein ErpA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=erpA PE=3 SV=2 86 212 2.0E-13
sp|A1S3U4|ERPA_SHEAM Iron-sulfur cluster insertion protein ErpA OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=erpA PE=3 SV=1 124 212 2.0E-13
sp|A4IZA5|ERPA_FRATW Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=erpA PE=3 SV=1 109 212 2.0E-13
sp|Q5NGX6|ERPA_FRATT Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=erpA PE=3 SV=1 109 212 2.0E-13
sp|Q0BKU2|ERPA_FRATO Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=erpA PE=3 SV=1 109 212 2.0E-13
sp|A0Q5J0|ERPA_FRATN Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. novicida (strain U112) GN=erpA PE=3 SV=1 109 212 2.0E-13
sp|B2SDK6|ERPA_FRATM Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=erpA PE=3 SV=1 109 212 2.0E-13
sp|Q2A270|ERPA_FRATH Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=erpA PE=3 SV=1 109 212 2.0E-13
sp|A7NDP2|ERPA_FRATF Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=erpA PE=3 SV=1 109 212 2.0E-13
sp|Q14IC8|ERPA_FRAT1 Iron-sulfur cluster insertion protein ErpA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=erpA PE=3 SV=1 109 212 2.0E-13
sp|Q8KA13|Y114_BUCAP Uncharacterized protein BUsg_114 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=BUsg_114 PE=3 SV=1 108 212 2.0E-13
sp|P46053|HESB_LEPBY Protein HesB OS=Leptolyngbya boryana GN=hesB PE=3 SV=1 109 210 2.0E-13
sp|C4K3H0|ERPA_HAMD5 Iron-sulfur cluster insertion protein ErpA OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=erpA PE=3 SV=1 109 212 2.0E-13
sp|B7VJJ4|ERPA_VIBTL Iron-sulfur cluster insertion protein ErpA OS=Vibrio tasmaniensis (strain LGP32) GN=erpA PE=3 SV=1 109 212 3.0E-13
sp|Q1QES5|ERPA_PSYCK Iron-sulfur cluster insertion protein ErpA OS=Psychrobacter cryohalolentis (strain K5) GN=erpA PE=3 SV=1 107 212 3.0E-13
sp|Q4FVP8|ERPA_PSYA2 Iron-sulfur cluster insertion protein ErpA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=erpA PE=3 SV=1 107 212 3.0E-13
sp|A7MUU6|ERPA_VIBCB Iron-sulfur cluster insertion protein ErpA OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=erpA PE=3 SV=2 109 212 3.0E-13
sp|A1ST94|ERPA_PSYIN Iron-sulfur cluster insertion protein ErpA OS=Psychromonas ingrahamii (strain 37) GN=erpA PE=3 SV=1 109 210 6.0E-13
sp|C3LSN2|ERPA_VIBCM Iron-sulfur cluster insertion protein ErpA OS=Vibrio cholerae serotype O1 (strain M66-2) GN=erpA PE=3 SV=1 109 212 7.0E-13
sp|Q9KU96|ERPA_VIBCH Iron-sulfur cluster insertion protein ErpA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=erpA PE=3 SV=1 109 212 7.0E-13
sp|A5F947|ERPA_VIBC3 Iron-sulfur cluster insertion protein ErpA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=erpA PE=3 SV=1 109 212 7.0E-13
sp|B0TZ08|ERPA_FRAP2 Iron-sulfur cluster insertion protein ErpA OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=erpA PE=3 SV=1 109 212 7.0E-13
sp|Q53211|Y4VC_RHISN Uncharacterized protein y4vC OS=Rhizobium sp. (strain NGR234) GN=NGR_a01210 PE=3 SV=1 109 210 8.0E-13
sp|Q86U28|ISCA2_HUMAN Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Homo sapiens GN=ISCA2 PE=1 SV=2 75 212 1.0E-12
sp|Q1XDR9|YCF83_PYRYE Uncharacterized protein ycf83 OS=Pyropia yezoensis GN=ycf83 PE=3 SV=1 102 210 1.0E-12
sp|Q3JC94|ERPA_NITOC Iron-sulfur cluster insertion protein ErpA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=erpA PE=3 SV=1 109 210 2.0E-12
sp|Q5R788|ISCA2_PONAB Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Pongo abelii GN=ISCA2 PE=2 SV=1 75 212 2.0E-12
sp|P46052|HESB2_ANAVT Protein HesB, vegetative OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hesB2 PE=2 SV=1 109 210 3.0E-12
sp|Q44540|YNIU_AZOVI Uncharacterized protein in nifU 5'region OS=Azotobacter vinelandii PE=3 SV=1 131 210 3.0E-12
sp|B8D7B5|ERPA_BUCAT Iron-sulfur cluster insertion protein ErpA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=erpA PE=3 SV=1 103 212 4.0E-12
sp|B8D910|ERPA_BUCA5 Iron-sulfur cluster insertion protein ErpA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=erpA PE=3 SV=1 103 212 4.0E-12
sp|Q5QVQ4|ERPA_IDILO Iron-sulfur cluster insertion protein ErpA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=erpA PE=3 SV=1 109 212 4.0E-12
sp|P57307|ERPA_BUCAI Iron-sulfur cluster insertion protein ErpA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=erpA PE=3 SV=1 103 212 6.0E-12
sp|P46045|NIFU_FRAAL Nitrogen fixation protein NifU OS=Frankia alni GN=nifU PE=3 SV=3 131 210 8.0E-12
sp|Q83AK7|ERPA_COXBU Iron-sulfur cluster insertion protein ErpA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=erpA PE=3 SV=2 109 210 1.0E-11
sp|A9NAW9|ERPA_COXBR Iron-sulfur cluster insertion protein ErpA OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=erpA PE=3 SV=1 109 210 1.0E-11
sp|A1KSG6|ERPA_NEIMF Putative iron-sulfur cluster insertion protein ErpA OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=erpA PE=3 SV=1 124 212 2.0E-11
sp|Q7DDN1|ERPA_NEIMB Putative iron-sulfur cluster insertion protein ErpA OS=Neisseria meningitidis serogroup B (strain MC58) GN=erpA PE=3 SV=1 124 212 2.0E-11
sp|A1IQG0|ERPA_NEIMA Putative iron-sulfur cluster insertion protein ErpA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=erpA PE=3 SV=1 124 212 2.0E-11
sp|Q5F6W8|ERPA_NEIG1 Putative iron-sulfur cluster insertion protein ErpA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=erpA PE=3 SV=1 124 212 2.0E-11
sp|P37029|Y1755_BRADU Uncharacterized protein blr1755 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr1755 PE=3 SV=2 109 210 4.0E-11
sp|A9KB96|ERPA_COXBN Iron-sulfur cluster insertion protein ErpA OS=Coxiella burnetii (strain Dugway 5J108-111) GN=erpA PE=3 SV=1 109 210 4.0E-11
sp|Q8LCY2|ISAM2_ARATH Iron-sulfur assembly protein IscA-like 2, mitochondrial OS=Arabidopsis thaliana GN=At5g03905 PE=2 SV=2 125 212 5.0E-11
sp|P0A5B0|Y2227_MYCBO Protein Mb2227c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2227c PE=1 SV=1 104 210 6.0E-11
sp|P9WMN5|Y2204_MYCTU Protein Rv2204c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2204c PE=1 SV=1 104 210 6.0E-11
sp|P9WMN4|Y2204_MYCTO Protein MT2260 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2260 PE=3 SV=1 104 210 6.0E-11
sp|Q9DCB8|ISCA2_MOUSE Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Mus musculus GN=Isca2 PE=1 SV=2 104 212 8.0E-11
sp|Q493N7|ERPA_BLOPB Iron-sulfur cluster insertion protein ErpA OS=Blochmannia pennsylvanicus (strain BPEN) GN=erpA PE=3 SV=1 131 212 1.0E-10
sp|Q01195|YNIU_RHOSH Uncharacterized protein in nifU 5'region OS=Rhodobacter sphaeroides PE=3 SV=1 109 210 1.0E-10
sp|Q60C62|ERPA1_METCA Iron-sulfur cluster insertion protein ErpA 1 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=erpA1 PE=3 SV=1 108 202 4.0E-10
sp|P18501|HESB_NOSS1 Protein HesB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hesB PE=3 SV=2 108 212 9.0E-10
sp|A1VJJ5|ERPA1_POLNA Putative iron-sulfur cluster insertion protein ErpA 1 OS=Polaromonas naphthalenivorans (strain CJ2) GN=erpA1 PE=3 SV=1 87 202 9.0E-10
sp|Q7VQH5|ERPA_BLOFL Iron-sulfur cluster insertion protein ErpA OS=Blochmannia floridanus GN=erpA PE=3 SV=1 109 212 1.0E-09
sp|Q2TBG7|ISCA2_BOVIN Iron-sulfur cluster assembly 2 homolog, mitochondrial OS=Bos taurus GN=ISCA2 PE=2 SV=1 104 212 2.0E-09
sp|P46051|HESB1_ANAVT Protein HesB, heterocyst OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hesB1 PE=2 SV=1 109 210 5.0E-09
sp|P51217|YCF83_PORPU Uncharacterized protein ycf83 OS=Porphyra purpurea GN=ycf83 PE=3 SV=1 109 210 6.0E-09
sp|Q5WWW0|ERPA_LEGPL Iron-sulfur cluster insertion protein ErpA OS=Legionella pneumophila (strain Lens) GN=erpA PE=3 SV=1 109 212 8.0E-09
sp|A5IBN0|ERPA_LEGPC Iron-sulfur cluster insertion protein ErpA OS=Legionella pneumophila (strain Corby) GN=erpA PE=3 SV=1 131 212 8.0E-09
sp|Q5X5H7|ERPA_LEGPA Iron-sulfur cluster insertion protein ErpA OS=Legionella pneumophila (strain Paris) GN=erpA PE=3 SV=1 131 212 8.0E-09
sp|Q5ZVQ2|ERPA_LEGPH Iron-sulfur cluster insertion protein ErpA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=erpA PE=3 SV=1 131 212 1.0E-08
sp|Q9ZE83|Y063_RICPR Uncharacterized protein RP063 OS=Rickettsia prowazekii (strain Madrid E) GN=RP063 PE=3 SV=1 108 212 1.0E-08
sp|O51930|ERPA_BUCAP Iron-sulfur cluster insertion protein ErpA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=erpA PE=3 SV=2 131 212 5.0E-08
sp|Q07184|YNIU_RHOCA Uncharacterized protein in nifU 5'region OS=Rhodobacter capsulatus PE=3 SV=1 131 210 3.0E-07
sp|Q8D3C7|ERPA_WIGBR Iron-sulfur cluster insertion protein ErpA OS=Wigglesworthia glossinidia brevipalpis GN=erpA PE=3 SV=1 132 212 4.0E-07
sp|Q89AW2|Y116_BUCBP Uncharacterized protein bbp_116 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=bbp_116 PE=3 SV=1 139 210 2.0E-06
sp|P57222|Y122_BUCAI Uncharacterized protein BU122 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=BU122 PE=3 SV=1 109 212 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5542
MNVSSYVARAASRHCRHPAWALSTARLAVSAYHSYSLPATAPRNGDLPETPIAQPEPLPRVHETRPPPPEHEPNA
ATPPPKAVEADAAPAQKPKAARPRPKLRARKAAMKLTPAAVEQLRTLLDQPEPKLIKVGVRNRGCSGLAYHLEYV
DKAGAFDETVEQDGVKVLIDSKALFSIIGSEMDWAEDKLNQRFIFKNPNIKEQCGCGESFMV*
Coding >Hirsu2|5542
ATGAACGTCTCCTCCTACGTGGCCCGCGCCGCCTCGCGGCACTGTCGCCACCCCGCCTGGGCCCTCTCGACAGCG
AGACTCGCCGTCTCCGCCTACCACTCCTACTCGTTGCCCGCCACCGCGCCACGGAATGGCGACCTGCCCGAGACG
CCCATCGCGCAGCCCGAGCCCCTACCGCGTGTGCACGAGACTCGTCCGCCGCCGCCCGAGCACGAACCCAACGCC
GCAACTCCCCCGCCCAAGGCCGTCGAGGCGGATGCGGCCCCGGCCCAGAAGCCCAAGGCTGCACGGCCCCGGCCC
AAGCTCCGCGCCCGCAAGGCCGCCATGAAACTCACGCCGGCCGCCGTCGAGCAGCTGCGCACGCTGCTCGACCAG
CCGGAGCCGAAGCTGATCAAGGTCGGCGTGCGGAACCGCGGCTGCAGCGGGCTGGCGTACCACCTGGAATACGTC
GACAAGGCCGGCGCATTCGACGAGACGGTAGAACAGGATGGTGTCAAGGTACTCATAGACAGCAAGGCCCTGTTT
AGCATCATCGGCAGCGAGATGGACTGGGCAGAGGACAAGCTGAACCAACGATTCATTTTCAAGAACCCCAACATA
AAGGAGCAATGTGGCTGTGGCGAATCATTCATGGTGTAG
Transcript >Hirsu2|5542
ATGAACGTCTCCTCCTACGTGGCCCGCGCCGCCTCGCGGCACTGTCGCCACCCCGCCTGGGCCCTCTCGACAGCG
AGACTCGCCGTCTCCGCCTACCACTCCTACTCGTTGCCCGCCACCGCGCCACGGAATGGCGACCTGCCCGAGACG
CCCATCGCGCAGCCCGAGCCCCTACCGCGTGTGCACGAGACTCGTCCGCCGCCGCCCGAGCACGAACCCAACGCC
GCAACTCCCCCGCCCAAGGCCGTCGAGGCGGATGCGGCCCCGGCCCAGAAGCCCAAGGCTGCACGGCCCCGGCCC
AAGCTCCGCGCCCGCAAGGCCGCCATGAAACTCACGCCGGCCGCCGTCGAGCAGCTGCGCACGCTGCTCGACCAG
CCGGAGCCGAAGCTGATCAAGGTCGGCGTGCGGAACCGCGGCTGCAGCGGGCTGGCGTACCACCTGGAATACGTC
GACAAGGCCGGCGCATTCGACGAGACGGTAGAACAGGATGGTGTCAAGGTACTCATAGACAGCAAGGCCCTGTTT
AGCATCATCGGCAGCGAGATGGACTGGGCAGAGGACAAGCTGAACCAACGATTCATTTTCAAGAACCCCAACATA
AAGGAGCAATGTGGCTGTGGCGAATCATTCATGGTGTAG
Gene >Hirsu2|5542
ATGAACGTCTCCTCCTACGTGGCCCGCGCCGCCTCGCGGCACTGTCGCCACCCCGCCTGGGCCCTCTCGACAGCG
AGACTCGCCGTCTCCGCCTACCACTCCTACTCGTTGCCCGCCACCGCGCCACGGAATGGCGACCTGCCCGAGACG
CCCATCGCGCAGCCCGAGCCCCTACCGCGTGTGCACGAGACTCGTCCGCCGCCGCCCGAGCACGAACCCAACGCC
GCAACTCCCCCGCCCAAGGCCGTCGAGGCGGATGCGGCCCCGGCCCAGAAGCCCAAGGCTGCACGGCCCCGGCCC
AAGCTCCGCGCCCGCAAGGCCGCCATGAAACTCACGCCGGCCGCCGTCGAGCAGCTGCGCACGCTGCTCGACCAG
CCGGAGCCGAAGCTGATCAAGGTCGGCGTGCGGAACCGCGGCTGCAGCGGGCTGGCGTACCACCTGGAATACGTC
GACAAGGCCGGCGCATTCGACGAGACGGTAGAACAGGATGGTGTCAAGGTACTCATAGACAGCAAGGCCCTGTTT
AGCATCATCGGCAGCGAGATGGACTGGGCAGAGGACAAGCTGAACCAACGATTCATTTTCAAGAACCCCAACATA
AGTATGCTTCCCGCTCGGCGGACACTCCGCCTCCCAGAACGAATCGAGAGGCTGACGCATGACAGAGGAGCAATG
TGGCTGTGGCGAATCATTCATGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail