Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5533
Gene name
LocationContig_2776:173..1326
Strand+
Gene length (bp)1153
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08643 DUF1776 Fungal family of unknown function (DUF1776) 1.1E-84 1 287

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole 0.3904 0.2874 0.0813 0.0511 0.2349 0.0375 0.3955 0.4757 0.4067 0.1168

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3146
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2468
Ophiocordyceps australis map64 (Brazil) OphauB2|4470
Ophiocordyceps camponoti-floridani Ophcf2|03334
Ophiocordyceps camponoti-rufipedis Ophun1|6815
Ophiocordyceps kimflemingae Ophio5|5229
Ophiocordyceps subramaniannii Hirsu2|5533 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5533
MERRGFVVYVVCNAAEDEALVHAFARPEIRPLTIDTTNPPRAGAAIERFASSLLSPPASSDTQTKSSQLTLKSVI
LIPSLHYQTSPIATIPPSSFADLFNTHLLQPILTIQAFLPLLTSRLNPIGERWIPPRVLVFTPSIISAINPPFHA
PEATVCSALSAFTEVLTAELRPLDIPVTHMQLGTFDFSGFVPSRAYAALVASSGSPQDTLGWPDGARHVYGRNYV
AQTSSAIAGGRVRGLRGSSLRRLHNAVFDVIDGSVAGDSVRVGLGASVYGLVGRWAPRGLVSWMMGVRRVDELST
WRAGSDDGSPLEPSDDGDATALTAPEFVAVPSEQNVWNTDMADSSLWVPSVSESS*
Coding >Hirsu2|5533
ATGGAGCGGCGCGGCTTCGTCGTCTACGTCGTCTGCAACGCCGCCGAGGATGAGGCCCTGGTCCATGCCTTTGCG
CGTCCGGAGATCCGGCCGCTGACCATCGACACCACCAACCCCCCCCGCGCCGGCGCGGCCATCGAGCGCTTCGCC
AGCTCTCTGCTGTCGCCGCCGGCGTCGTCGGACACGCAGACGAAGTCGAGCCAGCTGACGCTCAAGTCGGTCATC
CTCATCCCCAGCCTCCACTACCAGACGTCGCCCATCGCGACGATCCCGCCGTCCAGCTTCGCCGACCTCTTCAAC
ACGCACCTCCTGCAGCCGATCCTGACGATCCAGGCCTTCCTGCCGCTGCTGACGTCGCGGCTGAACCCCATTGGC
GAGCGGTGGATTCCGCCGCGGGTCCTCGTCTTCACGCCCTCCATCATCTCGGCCATCAACCCGCCCTTCCACGCG
CCCGAGGCAACCGTCTGCTCCGCCCTGTCGGCCTTCACCGAGGTCCTGACGGCCGAGCTGCGGCCGCTCGACATC
CCCGTCACCCACATGCAGCTCGGCACTTTCGACTTCTCCGGCTTCGTCCCCAGCCGGGCCTACGCCGCCCTCGTC
GCCTCCTCGGGCAGCCCGCAGGACACGCTCGGCTGGCCCGACGGCGCGCGCCACGTCTACGGCCGCAACTACGTG
GCCCAGACCAGCTCGGCCATCGCCGGCGGCCGCGTCCGCGGCCTGCGCGGCAGCTCGCTGCGCCGCCTGCACAAC
GCCGTCTTCGACGTCATCGACGGCTCCGTCGCCGGCGACTCGGTCCGCGTCGGCCTCGGCGCCAGCGTGTACGGT
CTCGTCGGCCGCTGGGCCCCGCGCGGCCTCGTCTCCTGGATGATGGGCGTCCGCCGCGTCGATGAGCTGTCGACC
TGGCGCGCCGGCTCGGACGACGGCTCGCCGCTCGAGCCCAGCGACGACGGCGACGCCACCGCCCTCACCGCCCCC
GAGTTCGTCGCCGTGCCCTCGGAGCAGAACGTATGGAACACGGACATGGCCGACAGCAGCCTCTGGGTGCCCTCT
GTGTCGGAGTCTTCCTAA
Transcript >Hirsu2|5533
ATGGAGCGGCGCGGCTTCGTCGTCTACGTCGTCTGCAACGCCGCCGAGGATGAGGCCCTGGTCCATGCCTTTGCG
CGTCCGGAGATCCGGCCGCTGACCATCGACACCACCAACCCCCCCCGCGCCGGCGCGGCCATCGAGCGCTTCGCC
AGCTCTCTGCTGTCGCCGCCGGCGTCGTCGGACACGCAGACGAAGTCGAGCCAGCTGACGCTCAAGTCGGTCATC
CTCATCCCCAGCCTCCACTACCAGACGTCGCCCATCGCGACGATCCCGCCGTCCAGCTTCGCCGACCTCTTCAAC
ACGCACCTCCTGCAGCCGATCCTGACGATCCAGGCCTTCCTGCCGCTGCTGACGTCGCGGCTGAACCCCATTGGC
GAGCGGTGGATTCCGCCGCGGGTCCTCGTCTTCACGCCCTCCATCATCTCGGCCATCAACCCGCCCTTCCACGCG
CCCGAGGCAACCGTCTGCTCCGCCCTGTCGGCCTTCACCGAGGTCCTGACGGCCGAGCTGCGGCCGCTCGACATC
CCCGTCACCCACATGCAGCTCGGCACTTTCGACTTCTCCGGCTTCGTCCCCAGCCGGGCCTACGCCGCCCTCGTC
GCCTCCTCGGGCAGCCCGCAGGACACGCTCGGCTGGCCCGACGGCGCGCGCCACGTCTACGGCCGCAACTACGTG
GCCCAGACCAGCTCGGCCATCGCCGGCGGCCGCGTCCGCGGCCTGCGCGGCAGCTCGCTGCGCCGCCTGCACAAC
GCCGTCTTCGACGTCATCGACGGCTCCGTCGCCGGCGACTCGGTCCGCGTCGGCCTCGGCGCCAGCGTGTACGGT
CTCGTCGGCCGCTGGGCCCCGCGCGGCCTCGTCTCCTGGATGATGGGCGTCCGCCGCGTCGATGAGCTGTCGACC
TGGCGCGCCGGCTCGGACGACGGCTCGCCGCTCGAGCCCAGCGACGACGGCGACGCCACCGCCCTCACCGCCCCC
GAGTTCGTCGCCGTGCCCTCGGAGCAGAACGTATGGAACACGGACATGGCCGACAGCAGCCTCTGGGTGCCCTCT
GTGTCGGAGTCTTCCTAA
Gene >Hirsu2|5533
ATGGAGCGGCGCGGCTTCGTCGTCTACGTCGTCTGCAACGCCGCCGAGGATGAGGCCCTGGTCCATGCCTTTGCG
CGTCCGGAGATCCGGCCGCTGACCATCGACACCACCAACGTGCGTATCGGGGATGCTCTTCTTGGAAACCGTTTT
TTTTTTCTTTTTTTCGTTTGCTGACTTCCGTTCTTCCCCCCACTGCCAGCCCCCCCGCGCCGGCGCGGCCATCGA
GCGCTTCGCCAGCTCTCTGCTGTCGCCGCCGGCGTCGTCGGACACGCAGACGAAGTCGAGCCAGCTGACGCTCAA
GTCGGTCATCCTCATCCCCAGCCTCCACTACCAGACGTCGCCCATCGCGACGATCCCGCCGTCCAGCTTCGCCGA
CCTCTTCAACACGCACCTCCTGCAGCCGATCCTGACGATCCAGGCCTTCCTGCCGCTGCTGACGTCGCGGCTGAA
CCCCATTGGCGAGCGGTGGATTCCGCCGCGGGTCCTCGTCTTCACGCCCTCCATCATCTCGGCCATCAACCCGCC
CTTCCACGCGCCCGAGGCAACCGTCTGCTCCGCCCTGTCGGCCTTCACCGAGGTCCTGACGGCCGAGCTGCGGCC
GCTCGACATCCCCGTCACCCACATGCAGCTCGGCACTTTCGACTTCTCCGGCTTCGTCCCCAGCCGGGCCTACGC
CGCCCTCGTCGCCTCCTCGGGCAGCCCGCAGGACACGCTCGGCTGGCCCGACGGCGCGCGCCACGTCTACGGCCG
CAACTACGTGGCCCAGACCAGCTCGGCCATCGCCGGCGGCCGCGTCCGCGGCCTGCGCGGCAGCTCGCTGCGCCG
CCTGCACAACGCCGTCTTCGACGTCATCGACGGCTCCGTCGCCGGCGACTCGGTCCGCGTCGGCCTCGGCGCCAG
CGTGTACGGTCTCGTCGGCCGCTGGGCCCCGCGCGGCCTCGTCTCCTGGATGATGGGCGTCCGCCGCGTCGATGA
GCTGTCGACCTGGCGCGCCGGCTCGGACGACGGCTCGCCGCTCGAGCCCAGCGACGACGGCGACGCCACCGCCCT
CACCGCCCCCGAGTTCGTCGCCGTGCCCTCGGAGCAGAACGTATGGAACACGGACATGGCCGACAGCAGCCTCTG
GGTGCCCTCTGTGTCGGAGTCTTCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail