Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5531
Gene name
LocationContig_2774:58..1576
Strand-
Gene length (bp)1518
Transcript length (bp)1518
Coding sequence length (bp)1518
Protein length (aa) 506

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00664 ABC_membrane ABC transporter transmembrane region 2.5E-19 140 312
PF00005 ABC_tran ABC transporter 6.1E-07 423 467

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 142 505 2.0E-51
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 142 505 6.0E-51
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 3 505 2.0E-49
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 142 505 3.0E-49
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 3 505 1.0E-48
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5F364|MRP1_CHICK Multidrug resistance-associated protein 1 OS=Gallus gallus GN=ABCC1 PE=2 SV=1 142 505 2.0E-51
sp|Q54P13|ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum GN=abcC8 PE=3 SV=1 142 505 6.0E-51
sp|Q864R9|MRP1_MACFA Multidrug resistance-associated protein 1 OS=Macaca fascicularis GN=ABCC1 PE=2 SV=1 3 505 2.0E-49
sp|O35379|MRP1_MOUSE Multidrug resistance-associated protein 1 OS=Mus musculus GN=Abcc1 PE=1 SV=1 142 505 3.0E-49
sp|P33527|MRP1_HUMAN Multidrug resistance-associated protein 1 OS=Homo sapiens GN=ABCC1 PE=1 SV=3 3 505 1.0E-48
sp|Q28689|MRP2_RABIT Canalicular multispecific organic anion transporter 1 OS=Oryctolagus cuniculus GN=ABCC2 PE=2 SV=1 1 505 4.0E-48
sp|Q8HXQ5|MRP1_BOVIN Multidrug resistance-associated protein 1 OS=Bos taurus GN=ABCC1 PE=2 SV=1 3 505 1.0E-47
sp|Q8CG09|MRP1_RAT Multidrug resistance-associated protein 1 OS=Rattus norvegicus GN=Abcc1 PE=1 SV=2 142 505 1.0E-47
sp|O15438|MRP3_HUMAN Canalicular multispecific organic anion transporter 2 OS=Homo sapiens GN=ABCC3 PE=1 SV=3 35 505 2.0E-47
sp|Q6UR05|MRP1_CANLF Multidrug resistance-associated protein 1 OS=Canis lupus familiaris GN=ABCC1 PE=2 SV=1 3 505 2.0E-47
sp|P53049|YOR1_YEAST Oligomycin resistance ATP-dependent permease YOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR1 PE=1 SV=1 139 505 2.0E-46
sp|Q92887|MRP2_HUMAN Canalicular multispecific organic anion transporter 1 OS=Homo sapiens GN=ABCC2 PE=1 SV=3 1 505 2.0E-46
sp|Q8VI47|MRP2_MOUSE Canalicular multispecific organic anion transporter 1 OS=Mus musculus GN=Abcc2 PE=1 SV=2 142 505 7.0E-46
sp|Q8ST87|ABCCA_DICDI ABC transporter C family member 10 OS=Dictyostelium discoideum GN=abcC10 PE=3 SV=1 1 505 3.0E-43
sp|B2RX12|MRP3_MOUSE Canalicular multispecific organic anion transporter 2 OS=Mus musculus GN=Abcc3 PE=1 SV=1 45 504 9.0E-43
sp|Q63120|MRP2_RAT Canalicular multispecific organic anion transporter 1 OS=Rattus norvegicus GN=Abcc2 PE=1 SV=1 142 505 2.0E-42
sp|Q54U44|ABCCC_DICDI ABC transporter C family member 12 OS=Dictyostelium discoideum GN=abcC12 PE=3 SV=1 142 505 4.0E-42
sp|Q42093|AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana GN=ABCC2 PE=1 SV=2 142 503 5.0E-42
sp|Q5T3U5|MRP7_HUMAN Multidrug resistance-associated protein 7 OS=Homo sapiens GN=ABCC10 PE=1 SV=1 140 505 7.0E-42
sp|O88563|MRP3_RAT Canalicular multispecific organic anion transporter 2 OS=Rattus norvegicus GN=Abcc3 PE=1 SV=1 142 504 1.0E-41
sp|Q54JR2|ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum GN=abcC3 PE=3 SV=1 27 505 2.0E-41
sp|Q10185|ABC2_SCHPO ATP-binding cassette transporter abc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc2 PE=1 SV=1 23 505 5.0E-41
sp|Q9C8H0|AB12C_ARATH ABC transporter C family member 12 OS=Arabidopsis thaliana GN=ABCC12 PE=2 SV=1 141 505 1.0E-40
sp|Q9C8G9|AB1C_ARATH ABC transporter C family member 1 OS=Arabidopsis thaliana GN=ABCC1 PE=1 SV=1 142 503 2.0E-40
sp|Q9SKX0|AB13C_ARATH ABC transporter C family member 13 OS=Arabidopsis thaliana GN=ABCC13 PE=2 SV=3 137 505 5.0E-40
sp|Q9C8H1|AB11C_ARATH ABC transporter C family member 11 OS=Arabidopsis thaliana GN=ABCC11 PE=2 SV=2 141 502 8.0E-39
sp|O15439|MRP4_HUMAN Multidrug resistance-associated protein 4 OS=Homo sapiens GN=ABCC4 PE=1 SV=3 141 505 1.0E-37
sp|Q96J65|MRP9_HUMAN Multidrug resistance-associated protein 9 OS=Homo sapiens GN=ABCC12 PE=1 SV=2 142 505 4.0E-37
sp|Q8R4P9|MRP7_MOUSE Multidrug resistance-associated protein 7 OS=Mus musculus GN=Abcc10 PE=1 SV=1 140 505 3.0E-36
sp|P39109|YCFI_YEAST Metal resistance protein YCF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCF1 PE=1 SV=2 142 505 8.0E-36
sp|P32386|YBT1_YEAST ATP-dependent bile acid permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBT1 PE=1 SV=2 43 505 1.0E-35
sp|O15440|MRP5_HUMAN Multidrug resistance-associated protein 5 OS=Homo sapiens GN=ABCC5 PE=1 SV=2 142 505 2.0E-35
sp|Q9P7V2|ABC4_SCHPO ATP-binding cassette transporter abc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc4 PE=3 SV=1 142 505 5.0E-35
sp|Q6Y306|MRP9_RAT Multidrug resistance-associated protein 9 OS=Rattus norvegicus GN=Abcc12 PE=2 SV=1 142 503 9.0E-35
sp|P14772|BPT1_YEAST Bile pigment transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BPT1 PE=1 SV=2 142 505 2.0E-34
sp|Q9LZJ5|AB14C_ARATH ABC transporter C family member 14 OS=Arabidopsis thaliana GN=ABCC14 PE=1 SV=1 142 505 2.0E-34
sp|Q5A762|MLT1_CANAL Multiple drug resistance-associated protein-like transporter 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MLT1 PE=1 SV=1 1 505 2.0E-34
sp|Q9QYM0|MRP5_RAT Multidrug resistance-associated protein 5 OS=Rattus norvegicus GN=Abcc5 PE=2 SV=1 142 505 4.0E-34
sp|Q9R1X5|MRP5_MOUSE Multidrug resistance-associated protein 5 OS=Mus musculus GN=Abcc5 PE=1 SV=2 142 505 4.0E-34
sp|Q7GB25|AB5C_ARATH ABC transporter C family member 5 OS=Arabidopsis thaliana GN=ABCC5 PE=2 SV=2 141 505 5.0E-34
sp|Q7DM58|AB4C_ARATH ABC transporter C family member 4 OS=Arabidopsis thaliana GN=ABCC4 PE=2 SV=2 142 505 1.0E-33
sp|Q80WJ6|MRP9_MOUSE Multidrug resistance-associated protein 9 OS=Mus musculus GN=Abcc12 PE=2 SV=1 142 503 1.0E-33
sp|Q9P5N0|ABC3_SCHPO ATP-binding cassette transporter abc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc3 PE=2 SV=1 9 505 2.0E-33
sp|Q54VJ0|ABCC2_DICDI ABC transporter C family member 2 OS=Dictyostelium discoideum GN=abcC2 PE=3 SV=1 139 505 5.0E-33
sp|Q9LYS2|AB10C_ARATH ABC transporter C family member 10 OS=Arabidopsis thaliana GN=ABCC10 PE=2 SV=2 144 504 9.0E-33
sp|Q54EK2|ABCC7_DICDI ABC transporter C family member 7 OS=Dictyostelium discoideum GN=abcC7 PE=3 SV=1 139 505 4.0E-32
sp|Q8T6H8|ABCC1_DICDI ABC transporter C family member 1 OS=Dictyostelium discoideum GN=abcC1 PE=3 SV=1 136 505 8.0E-32
sp|Q10RX7|AB13C_ORYSJ ABC transporter C family member 13 OS=Oryza sativa subsp. japonica GN=ABCC13 PE=2 SV=1 141 505 1.0E-31
sp|A2XCD4|AB13C_ORYSI ABC transporter C family member 13 OS=Oryza sativa subsp. indica GN=ABCC13 PE=3 SV=1 141 505 1.0E-31
sp|P38735|VMR1_YEAST ABC transporter ATP-binding protein/permease VMR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMR1 PE=2 SV=1 142 505 1.0E-31
sp|Q54LE6|ABCC5_DICDI ABC transporter C family member 5 OS=Dictyostelium discoideum GN=abcC5 PE=3 SV=1 141 505 2.0E-31
sp|P21441|MDR_LEITA Multidrug resistance protein OS=Leishmania tarentolae GN=PGPA PE=3 SV=2 1 490 6.0E-31
sp|Q92337|ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=abc1 PE=3 SV=1 135 505 1.0E-30
sp|P91660|L259_DROME Probable multidrug resistance-associated protein lethal(2)03659 OS=Drosophila melanogaster GN=l(2)03659 PE=2 SV=3 141 504 1.0E-30
sp|Q63563|ABCC9_RAT ATP-binding cassette sub-family C member 9 OS=Rattus norvegicus GN=Abcc9 PE=1 SV=1 142 505 4.0E-30
sp|P70170|ABCC9_MOUSE ATP-binding cassette sub-family C member 9 OS=Mus musculus GN=Abcc9 PE=1 SV=2 142 505 7.0E-30
sp|P82451|ABCC9_RABIT ATP-binding cassette sub-family C member 9 OS=Oryctolagus cuniculus GN=ABCC9 PE=2 SV=1 142 505 8.0E-30
sp|O60706|ABCC9_HUMAN ATP-binding cassette sub-family C member 9 OS=Homo sapiens GN=ABCC9 PE=1 SV=2 142 505 9.0E-30
sp|O95255|MRP6_HUMAN Multidrug resistance-associated protein 6 OS=Homo sapiens GN=ABCC6 PE=1 SV=2 142 505 1.0E-28
sp|Q09429|ABCC8_RAT ATP-binding cassette sub-family C member 8 OS=Rattus norvegicus GN=Abcc8 PE=1 SV=4 142 505 1.0E-28
sp|A7KVC2|AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays GN=MRP4 PE=2 SV=1 141 505 3.0E-28
sp|Q09428|ABCC8_HUMAN ATP-binding cassette sub-family C member 8 OS=Homo sapiens GN=ABCC8 PE=1 SV=6 142 505 4.0E-28
sp|Q09427|ABCC8_CRICR ATP-binding cassette sub-family C member 8 OS=Cricetus cricetus GN=ABCC8 PE=1 SV=3 142 505 4.0E-28
sp|Q2IBB3|CFTR_RHIFE Cystic fibrosis transmembrane conductance regulator OS=Rhinolophus ferrumequinum GN=CFTR PE=3 SV=1 142 505 5.0E-28
sp|Q7FB56|AB15C_ARATH Putative ABC transporter C family member 15 OS=Arabidopsis thaliana GN=ABCC15 PE=5 SV=2 148 505 7.0E-27
sp|Q108U0|CFTR_LOXAF Cystic fibrosis transmembrane conductance regulator OS=Loxodonta africana GN=CFTR PE=3 SV=1 142 505 1.0E-26
sp|Q8T6H3|ABCC6_DICDI ABC transporter C family member 6 OS=Dictyostelium discoideum GN=abcC6 PE=3 SV=1 1 505 2.0E-26
sp|Q9M1C7|AB9C_ARATH ABC transporter C family member 9 OS=Arabidopsis thaliana GN=ABCC9 PE=2 SV=2 8 505 2.0E-26
sp|Q09YH0|CFTR_SAIBB Cystic fibrosis transmembrane conductance regulator OS=Saimiri boliviensis boliviensis GN=CFTR PE=3 SV=1 142 505 2.0E-26
sp|Q00554|CFTR_RABIT Cystic fibrosis transmembrane conductance regulator OS=Oryctolagus cuniculus GN=CFTR PE=2 SV=4 142 505 2.0E-26
sp|Q5U820|CFTR_CANLF Cystic fibrosis transmembrane conductance regulator OS=Canis lupus familiaris GN=CFTR PE=2 SV=2 142 505 2.0E-26
sp|Q2IBE4|CFTR_PONAB Cystic fibrosis transmembrane conductance regulator OS=Pongo abelii GN=CFTR PE=3 SV=1 142 505 2.0E-26
sp|Q96J66|ABCCB_HUMAN ATP-binding cassette sub-family C member 11 OS=Homo sapiens GN=ABCC11 PE=1 SV=1 161 505 3.0E-26
sp|Q09YK5|CFTR_ATEGE Cystic fibrosis transmembrane conductance regulator OS=Ateles geoffroyi GN=CFTR PE=3 SV=1 142 505 3.0E-26
sp|Q54NL1|ABCC9_DICDI ABC transporter C family member 9 OS=Dictyostelium discoideum GN=abcC9 PE=3 SV=1 47 505 3.0E-26
sp|Q2IBA1|CFTR_CHLAE Cystic fibrosis transmembrane conductance regulator OS=Chlorocebus aethiops GN=CFTR PE=3 SV=1 142 505 3.0E-26
sp|Q2IBF6|CFTR_GORGO Cystic fibrosis transmembrane conductance regulator OS=Gorilla gorilla gorilla GN=CFTR PE=3 SV=1 142 505 4.0E-26
sp|Q07DX5|CFTR_NOMLE Cystic fibrosis transmembrane conductance regulator OS=Nomascus leucogenys GN=CFTR PE=3 SV=1 142 505 4.0E-26
sp|P13569|CFTR_HUMAN Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens GN=CFTR PE=1 SV=3 142 505 5.0E-26
sp|Q6PQZ2|CFTR_PIG Cystic fibrosis transmembrane conductance regulator OS=Sus scrofa GN=CFTR PE=2 SV=1 142 505 6.0E-26
sp|Q2QLF9|CFTR_CALJA Cystic fibrosis transmembrane conductance regulator OS=Callithrix jacchus GN=CFTR PE=3 SV=1 142 505 6.0E-26
sp|Q2QLE5|CFTR_PANTR Cystic fibrosis transmembrane conductance regulator OS=Pan troglodytes GN=CFTR PE=3 SV=1 142 505 6.0E-26
sp|P26361|CFTR_MOUSE Cystic fibrosis transmembrane conductance regulator OS=Mus musculus GN=Cftr PE=1 SV=2 142 505 7.0E-26
sp|Q07DV2|CFTR_AOTNA Cystic fibrosis transmembrane conductance regulator OS=Aotus nancymaae GN=CFTR PE=3 SV=1 142 505 7.0E-26
sp|Q00PJ2|CFTR_ATEAB Cystic fibrosis transmembrane conductance regulator OS=Atelerix albiventris GN=CFTR PE=3 SV=1 142 505 7.0E-26
sp|Q2QLB4|CFTR_CALMO Cystic fibrosis transmembrane conductance regulator OS=Callicebus moloch GN=CFTR PE=3 SV=1 142 505 1.0E-25
sp|Q9TSP5|CFTR_PAPAN Cystic fibrosis transmembrane conductance regulator OS=Papio anubis GN=CFTR PE=3 SV=1 142 505 1.0E-25
sp|Q00553|CFTR_MACMU Cystic fibrosis transmembrane conductance regulator OS=Macaca mulatta GN=CFTR PE=2 SV=2 142 505 1.0E-25
sp|Q7JII7|CFTR_MACFU Cystic fibrosis transmembrane conductance regulator OS=Macaca fuscata fuscata GN=CFTR PE=3 SV=1 142 505 1.0E-25
sp|Q7JII8|CFTR_MACFA Cystic fibrosis transmembrane conductance regulator OS=Macaca fascicularis GN=CFTR PE=3 SV=1 142 505 1.0E-25
sp|Q9TUQ2|CFTR_MACNE Cystic fibrosis transmembrane conductance regulator OS=Macaca nemestrina GN=CFTR PE=3 SV=1 142 505 1.0E-25
sp|Q07E16|CFTR_MUSPF Cystic fibrosis transmembrane conductance regulator OS=Mustela putorius furo GN=CFTR PE=3 SV=1 142 505 1.0E-25
sp|Q07DY5|CFTR_COLGU Cystic fibrosis transmembrane conductance regulator OS=Colobus guereza GN=CFTR PE=3 SV=1 142 505 2.0E-25
sp|Q5D1Z7|CFTR_TRIVU Cystic fibrosis transmembrane conductance regulator OS=Trichosurus vulpecula GN=CFTR PE=2 SV=1 141 505 2.0E-25
sp|Q2QLH0|CFTR_OTOGA Cystic fibrosis transmembrane conductance regulator OS=Otolemur garnettii GN=CFTR PE=3 SV=1 142 505 2.0E-25
sp|Q2QL74|CFTR_DIDVI Cystic fibrosis transmembrane conductance regulator OS=Didelphis virginiana GN=CFTR PE=3 SV=1 142 505 4.0E-25
sp|Q2QL83|CFTR_MICMU Cystic fibrosis transmembrane conductance regulator OS=Microcebus murinus GN=CFTR PE=3 SV=1 142 505 4.0E-25
sp|Q8VZZ4|AB6C_ARATH ABC transporter C family member 6 OS=Arabidopsis thaliana GN=ABCC6 PE=2 SV=3 7 505 6.0E-25
sp|P26362|CFTR_SQUAC Cystic fibrosis transmembrane conductance regulator OS=Squalus acanthias GN=CFTR PE=1 SV=1 142 505 6.0E-25
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1 144 505 6.0E-25
sp|Q2QLA3|CFTR_HORSE Cystic fibrosis transmembrane conductance regulator OS=Equus caballus GN=CFTR PE=3 SV=1 142 505 8.0E-25
sp|Q07E42|CFTR_DASNO Cystic fibrosis transmembrane conductance regulator OS=Dasypus novemcinctus GN=CFTR PE=3 SV=1 142 505 5.0E-24
sp|Q09YJ4|CFTR_MUNMU Cystic fibrosis transmembrane conductance regulator OS=Muntiacus muntjak GN=CFTR PE=3 SV=1 142 505 9.0E-24
sp|Q07DW5|CFTR_MUNRE Cystic fibrosis transmembrane conductance regulator OS=Muntiacus reevesi GN=CFTR PE=3 SV=1 142 505 1.0E-23
sp|Q00552|CFTR_CAVPO Cystic fibrosis transmembrane conductance regulator OS=Cavia porcellus GN=CFTR PE=2 SV=2 142 505 2.0E-23
sp|P35071|CFTR_BOVIN Cystic fibrosis transmembrane conductance regulator OS=Bos taurus GN=CFTR PE=2 SV=2 142 505 3.0E-23
sp|Q8LGU1|AB8C_ARATH ABC transporter C family member 8 OS=Arabidopsis thaliana GN=ABCC8 PE=2 SV=3 141 505 6.0E-23
sp|Q2QLC5|CFTR_CARPS Cystic fibrosis transmembrane conductance regulator OS=Carollia perspicillata GN=CFTR PE=3 SV=1 142 505 2.0E-22
sp|O88269|MRP6_RAT Multidrug resistance-associated protein 6 OS=Rattus norvegicus GN=Abcc6 PE=1 SV=1 142 505 3.0E-22
sp|Q9R1S7|MRP6_MOUSE Multidrug resistance-associated protein 6 OS=Mus musculus GN=Abcc6 PE=1 SV=3 142 505 3.0E-22
sp|P26363|CFTR_XENLA Cystic fibrosis transmembrane conductance regulator OS=Xenopus laevis GN=cftr PE=2 SV=1 142 505 4.0E-22
sp|Q9LK62|AB7C_ARATH ABC transporter C family member 7 OS=Arabidopsis thaliana GN=ABCC7 PE=1 SV=1 8 505 1.0E-21
sp|Q07DZ6|CFTR_ORNAN Cystic fibrosis transmembrane conductance regulator OS=Ornithorhynchus anatinus GN=CFTR PE=3 SV=1 141 505 1.0E-21
sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum GN=abcC15 PE=3 SV=1 142 505 2.0E-21
sp|Q00555|CFTR_SHEEP Cystic fibrosis transmembrane conductance regulator OS=Ovis aries GN=CFTR PE=1 SV=2 142 505 2.0E-21
sp|Q9LK64|AB3C_ARATH ABC transporter C family member 3 OS=Arabidopsis thaliana GN=ABCC3 PE=1 SV=1 32 505 5.0E-21
sp|P34158|CFTR_RAT Cystic fibrosis transmembrane conductance regulator OS=Rattus norvegicus GN=Cftr PE=1 SV=3 142 505 1.0E-20
sp|P0CE70|NFT1_YEASX ABC transporter NFT1 OS=Saccharomyces cerevisiae GN=NFT1 PE=3 SV=1 43 505 8.0E-19
sp|C8ZCR2|NFT1_YEAS8 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=NFT1 PE=3 SV=1 43 505 9.0E-19
sp|A7A063|NFT1_YEAS7 ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain YJM789) GN=NFT1 PE=3 SV=1 43 505 2.0E-18
sp|P0CE68|NFT1_YEAST ABC transporter NFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NFT1 PE=3 SV=1 43 505 2.0E-18
sp|Q9VL32|SUR_DROME ATP-binding cassette sub-family C member Sur OS=Drosophila melanogaster GN=Sur PE=1 SV=4 71 343 7.0E-15
sp|Q54K24|ABCCE_DICDI ABC transporter C family member 14 OS=Dictyostelium discoideum GN=abcC14 PE=3 SV=1 1 343 3.0E-14
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0042626 ATPase activity, coupled to transmembrane movement of substances Yes
GO:0055085 transmembrane transport Yes
GO:0005524 ATP binding Yes
GO:0016887 ATPase activity Yes
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0043168 anion binding No
GO:0051234 establishment of localization No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0022804 active transmembrane transporter activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0051179 localization No
GO:0044425 membrane part No
GO:0031224 intrinsic component of membrane No
GO:0042623 ATPase activity, coupled No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043492 ATPase activity, coupled to movement of substances No
GO:0022857 transmembrane transporter activity No
GO:0015405 P-P-bond-hydrolysis-driven transmembrane transporter activity No
GO:0006810 transport No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 33 55 22
2 161 183 22
3 187 209 22
4 269 291 22
5 301 323 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5531
MAPFTLRYLIQFATDAYVANVSHQPPPHIGRGVGLVLGITAMQVLQSLCISHFIYRGMMMGGQTRGVLISMIYEK
AMVISGRARAGSTKRPSMVVGDEQRPEGEGAEEKGQEDAPNRKPIDPKSKKKGKGDKKPDGTGWPNGRIVNLMSV
DTYRIDQASALFHMLWTSPILCIITLVLLLINLTYSALAGFALLVIGVPALTRAIQSLLRRRKRINAITDQRVSL
TQEILQSVRFVKYFGWEKAFMDRLEQLRSREIHAIQILLAIRNAINAISMSLPIFASMLSFITYSLSHHSLSPAS
IFSSLALFNGLRIPLNLMPLVLGQVTDAWSSLKRIEEFLMEEEQEEDAILKPEASNAIELSHASFTWERTPGQES
GKGGGTGADRDKKTGAAKANKPAEANRPGSARGDTASTLVEEREPFKLQGLDFEAGRNELIAVIGSVGSGKSSLL
AALAGDMRKTSGEVVFGASRAFCPQYAWIQNTTLRNNITFGKDMDKRWYRKVIKA*
Coding >Hirsu2|5531
ATGGCCCCCTTTACCCTCCGCTACCTGATCCAGTTTGCCACCGACGCCTACGTGGCCAACGTTTCTCACCAGCCG
CCCCCGCACATTGGCCGCGGGGTTGGGCTCGTCCTCGGTATCACGGCCATGCAGGTCCTACAAAGCCTGTGCATC
AGCCACTTCATATATCGCGGCATGATGATGGGCGGTCAGACCCGCGGCGTCCTCATCAGCATGATATACGAAAAG
GCCATGGTCATCTCGGGCAGGGCTCGCGCCGGTAGCACGAAGAGGCCGTCGATGGTCGTTGGCGATGAGCAGCGG
CCCGAGGGCGAAGGAGCGGAGGAGAAAGGACAGGAGGACGCACCCAATCGCAAGCCGATTGATCCCAAGTCGAAG
AAAAAGGGCAAGGGAGACAAGAAGCCTGACGGCACCGGGTGGCCCAACGGCCGCATCGTCAACCTCATGAGCGTC
GACACCTACCGCATCGACCAAGCCTCGGCCCTCTTCCACATGCTCTGGACCTCCCCCATCCTATGCATCATCACC
CTTGTCCTGCTTCTCATAAATCTGACGTACAGCGCCCTGGCGGGCTTCGCTCTGCTCGTCATCGGCGTCCCTGCG
CTGACCAGGGCCATCCAGAGCCTGTTGCGCCGCCGGAAGAGGATCAACGCCATCACCGACCAGCGCGTCTCCCTC
ACCCAGGAGATTCTCCAGTCAGTTCGGTTCGTCAAGTACTTTGGCTGGGAGAAGGCCTTCATGGACCGTCTCGAG
CAGCTCCGGTCCAGGGAGATCCACGCCATCCAGATTCTGCTGGCCATCCGAAACGCCATCAACGCCATCAGCATG
TCGCTGCCCATCTTCGCCTCGATGCTCTCCTTCATAACCTACTCGCTCTCCCACCACTCGCTCTCCCCGGCCTCC
ATCTTCTCCTCCCTGGCCCTCTTCAACGGCCTCCGCATCCCGCTCAACCTGATGCCTCTTGTCCTGGGCCAGGTC
ACGGACGCTTGGTCTTCGCTCAAGCGCATCGAAGAGTTTCTCATGGAAGAGGAGCAGGAGGAGGACGCCATCCTG
AAGCCCGAGGCGAGCAACGCGATCGAGCTGAGCCATGCCTCCTTCACATGGGAACGCACTCCCGGCCAAGAATCC
GGCAAGGGTGGCGGCACCGGAGCCGACAGGGACAAGAAGACCGGCGCAGCCAAGGCGAACAAGCCCGCCGAGGCC
AATCGCCCCGGCTCCGCGAGAGGGGATACCGCCAGCACCCTCGTGGAGGAGCGAGAGCCCTTCAAGCTGCAGGGA
CTCGACTTTGAGGCGGGCCGGAACGAGCTGATCGCCGTCATCGGCTCGGTCGGCAGTGGGAAGAGCTCGCTGCTC
GCCGCCCTCGCCGGGGACATGCGCAAGACGAGCGGAGAAGTCGTCTTCGGCGCATCCAGGGCCTTTTGCCCACAG
TACGCCTGGATTCAGAACACGACACTCCGGAACAACATCACCTTTGGCAAGGACATGGACAAGCGCTGGTATAGG
AAGGTCATTAAAGCGTAA
Transcript >Hirsu2|5531
ATGGCCCCCTTTACCCTCCGCTACCTGATCCAGTTTGCCACCGACGCCTACGTGGCCAACGTTTCTCACCAGCCG
CCCCCGCACATTGGCCGCGGGGTTGGGCTCGTCCTCGGTATCACGGCCATGCAGGTCCTACAAAGCCTGTGCATC
AGCCACTTCATATATCGCGGCATGATGATGGGCGGTCAGACCCGCGGCGTCCTCATCAGCATGATATACGAAAAG
GCCATGGTCATCTCGGGCAGGGCTCGCGCCGGTAGCACGAAGAGGCCGTCGATGGTCGTTGGCGATGAGCAGCGG
CCCGAGGGCGAAGGAGCGGAGGAGAAAGGACAGGAGGACGCACCCAATCGCAAGCCGATTGATCCCAAGTCGAAG
AAAAAGGGCAAGGGAGACAAGAAGCCTGACGGCACCGGGTGGCCCAACGGCCGCATCGTCAACCTCATGAGCGTC
GACACCTACCGCATCGACCAAGCCTCGGCCCTCTTCCACATGCTCTGGACCTCCCCCATCCTATGCATCATCACC
CTTGTCCTGCTTCTCATAAATCTGACGTACAGCGCCCTGGCGGGCTTCGCTCTGCTCGTCATCGGCGTCCCTGCG
CTGACCAGGGCCATCCAGAGCCTGTTGCGCCGCCGGAAGAGGATCAACGCCATCACCGACCAGCGCGTCTCCCTC
ACCCAGGAGATTCTCCAGTCAGTTCGGTTCGTCAAGTACTTTGGCTGGGAGAAGGCCTTCATGGACCGTCTCGAG
CAGCTCCGGTCCAGGGAGATCCACGCCATCCAGATTCTGCTGGCCATCCGAAACGCCATCAACGCCATCAGCATG
TCGCTGCCCATCTTCGCCTCGATGCTCTCCTTCATAACCTACTCGCTCTCCCACCACTCGCTCTCCCCGGCCTCC
ATCTTCTCCTCCCTGGCCCTCTTCAACGGCCTCCGCATCCCGCTCAACCTGATGCCTCTTGTCCTGGGCCAGGTC
ACGGACGCTTGGTCTTCGCTCAAGCGCATCGAAGAGTTTCTCATGGAAGAGGAGCAGGAGGAGGACGCCATCCTG
AAGCCCGAGGCGAGCAACGCGATCGAGCTGAGCCATGCCTCCTTCACATGGGAACGCACTCCCGGCCAAGAATCC
GGCAAGGGTGGCGGCACCGGAGCCGACAGGGACAAGAAGACCGGCGCAGCCAAGGCGAACAAGCCCGCCGAGGCC
AATCGCCCCGGCTCCGCGAGAGGGGATACCGCCAGCACCCTCGTGGAGGAGCGAGAGCCCTTCAAGCTGCAGGGA
CTCGACTTTGAGGCGGGCCGGAACGAGCTGATCGCCGTCATCGGCTCGGTCGGCAGTGGGAAGAGCTCGCTGCTC
GCCGCCCTCGCCGGGGACATGCGCAAGACGAGCGGAGAAGTCGTCTTCGGCGCATCCAGGGCCTTTTGCCCACAG
TACGCCTGGATTCAGAACACGACACTCCGGAACAACATCACCTTTGGCAAGGACATGGACAAGCGCTGGTATAGG
AAGGTCATTAAAGCGTAA
Gene >Hirsu2|5531
ATGGCCCCCTTTACCCTCCGCTACCTGATCCAGTTTGCCACCGACGCCTACGTGGCCAACGTTTCTCACCAGCCG
CCCCCGCACATTGGCCGCGGGGTTGGGCTCGTCCTCGGTATCACGGCCATGCAGGTCCTACAAAGCCTGTGCATC
AGCCACTTCATATATCGCGGCATGATGATGGGCGGTCAGACCCGCGGCGTCCTCATCAGCATGATATACGAAAAG
GCCATGGTCATCTCGGGCAGGGCTCGCGCCGGTAGCACGAAGAGGCCGTCGATGGTCGTTGGCGATGAGCAGCGG
CCCGAGGGCGAAGGAGCGGAGGAGAAAGGACAGGAGGACGCACCCAATCGCAAGCCGATTGATCCCAAGTCGAAG
AAAAAGGGCAAGGGAGACAAGAAGCCTGACGGCACCGGGTGGCCCAACGGCCGCATCGTCAACCTCATGAGCGTC
GACACCTACCGCATCGACCAAGCCTCGGCCCTCTTCCACATGCTCTGGACCTCCCCCATCCTATGCATCATCACC
CTTGTCCTGCTTCTCATAAATCTGACGTACAGCGCCCTGGCGGGCTTCGCTCTGCTCGTCATCGGCGTCCCTGCG
CTGACCAGGGCCATCCAGAGCCTGTTGCGCCGCCGGAAGAGGATCAACGCCATCACCGACCAGCGCGTCTCCCTC
ACCCAGGAGATTCTCCAGTCAGTTCGGTTCGTCAAGTACTTTGGCTGGGAGAAGGCCTTCATGGACCGTCTCGAG
CAGCTCCGGTCCAGGGAGATCCACGCCATCCAGATTCTGCTGGCCATCCGAAACGCCATCAACGCCATCAGCATG
TCGCTGCCCATCTTCGCCTCGATGCTCTCCTTCATAACCTACTCGCTCTCCCACCACTCGCTCTCCCCGGCCTCC
ATCTTCTCCTCCCTGGCCCTCTTCAACGGCCTCCGCATCCCGCTCAACCTGATGCCTCTTGTCCTGGGCCAGGTC
ACGGACGCTTGGTCTTCGCTCAAGCGCATCGAAGAGTTTCTCATGGAAGAGGAGCAGGAGGAGGACGCCATCCTG
AAGCCCGAGGCGAGCAACGCGATCGAGCTGAGCCATGCCTCCTTCACATGGGAACGCACTCCCGGCCAAGAATCC
GGCAAGGGTGGCGGCACCGGAGCCGACAGGGACAAGAAGACCGGCGCAGCCAAGGCGAACAAGCCCGCCGAGGCC
AATCGCCCCGGCTCCGCGAGAGGGGATACCGCCAGCACCCTCGTGGAGGAGCGAGAGCCCTTCAAGCTGCAGGGA
CTCGACTTTGAGGCGGGCCGGAACGAGCTGATCGCCGTCATCGGCTCGGTCGGCAGTGGGAAGAGCTCGCTGCTC
GCCGCCCTCGCCGGGGACATGCGCAAGACGAGCGGAGAAGTCGTCTTCGGCGCATCCAGGGCCTTTTGCCCACAG
TACGCCTGGATTCAGAACACGACACTCCGGAACAACATCACCTTTGGCAAGGACATGGACAAGCGCTGGTATAGG
AAGGTCATTAAAGCGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail