Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5523
Gene name
LocationContig_277:4772..6441
Strand-
Gene length (bp)1669
Transcript length (bp)1398
Coding sequence length (bp)1398
Protein length (aa) 466

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10312 Cactin_mid Conserved mid region of cactin 1.1E-59 45 231
PF09732 CactinC_cactus Cactus-binding C-terminus of cactin protein 7.1E-57 328 465

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14342|YB3C_SCHPO Uncharacterized protein C2F12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.12c PE=4 SV=1 39 465 3.0E-76
sp|Q9VR99|CATIN_DROME Cactin OS=Drosophila melanogaster GN=cactin PE=1 SV=3 49 465 1.0E-69
sp|F4I2J8|CATIN_ARATH Cactin OS=Arabidopsis thaliana GN=CTN PE=1 SV=1 328 465 5.0E-55
sp|Q8WUQ7|CATIN_HUMAN Cactin OS=Homo sapiens GN=CACTIN PE=1 SV=3 290 465 5.0E-51
sp|B6KG46|CATIN_TOXGO Cactin OS=Toxoplasma gondii GN=CACTIN PE=1 SV=2 328 465 2.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14342|YB3C_SCHPO Uncharacterized protein C2F12.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2F12.12c PE=4 SV=1 39 465 3.0E-76
sp|Q9VR99|CATIN_DROME Cactin OS=Drosophila melanogaster GN=cactin PE=1 SV=3 49 465 1.0E-69
sp|F4I2J8|CATIN_ARATH Cactin OS=Arabidopsis thaliana GN=CTN PE=1 SV=1 328 465 5.0E-55
sp|Q8WUQ7|CATIN_HUMAN Cactin OS=Homo sapiens GN=CACTIN PE=1 SV=3 290 465 5.0E-51
sp|B6KG46|CATIN_TOXGO Cactin OS=Toxoplasma gondii GN=CACTIN PE=1 SV=2 328 465 2.0E-50
sp|Q9CS00|CATIN_MOUSE Cactin OS=Mus musculus GN=Cactin PE=1 SV=2 290 465 1.0E-49
sp|F1Q8W0|CATIN_DANRE Cactin OS=Danio rerio GN=cactin PE=2 SV=1 290 465 1.0E-48
sp|G5EG14|CATIN_CAEEL Cactin OS=Caenorhabditis elegans GN=cacn-1 PE=1 SV=1 303 465 7.0E-48
sp|Q8WUQ7|CATIN_HUMAN Cactin OS=Homo sapiens GN=CACTIN PE=1 SV=3 40 295 9.0E-23
sp|F1Q8W0|CATIN_DANRE Cactin OS=Danio rerio GN=cactin PE=2 SV=1 48 228 1.0E-22
sp|Q9CS00|CATIN_MOUSE Cactin OS=Mus musculus GN=Cactin PE=1 SV=2 40 228 6.0E-22
sp|F4I2J8|CATIN_ARATH Cactin OS=Arabidopsis thaliana GN=CTN PE=1 SV=1 57 231 5.0E-13
sp|G5EG14|CATIN_CAEEL Cactin OS=Caenorhabditis elegans GN=cacn-1 PE=1 SV=1 57 228 4.0E-08
sp|B6KG46|CATIN_TOXGO Cactin OS=Toxoplasma gondii GN=CACTIN PE=1 SV=2 48 240 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5523
MIENQKLSKSKNITAPRVDPNTRVNKASRRAPKAKTAQRASNYLTQDEQSRQFVADEDKFVLRQSKKKADIRVRE
GRAKPIDRLTFSLRYIDADRDVFDDDEGDLGIELQAPAAVVEELGADQLDELQSDIGTLLVLERDATNRQYWEAL
VTLCKDRKSKLDPRSREDRVLSSVAEDIDKILKPKTYDQLEALEKQIEAKLRSNEDIDTDYWEQLLRNLLVWKSR
ATLTRIFEATSAARATLLEGREKPDEPQAMTEHASLLSSFRPPNVVTGNAAGPSSSAAPAAGNEDVSQATKALYD
REAARGISENEEIFTAEEAVPGHAKPRWTDKYRARKPRYFNRVQMGYEWNKYNQTHYDHDNPPPKVVQGYKFNIF
YPELIDKTKAPTFKIIREHGRRRGQSHAAAGEADTCLIHFISGPPYEDIAFRIVDREWDFSAKKERGFRSTFDRG
ILQLHFQFKKIFYRK*
Coding >Hirsu2|5523
ATGATAGAGAACCAGAAACTCTCCAAAAGCAAAAACATCACGGCCCCGCGAGTTGACCCCAACACCCGAGTCAAC
AAGGCGTCACGGCGAGCCCCCAAAGCGAAGACGGCTCAGAGGGCCTCTAATTACCTCACGCAAGACGAGCAGTCC
CGCCAATTCGTGGCCGACGAGGACAAGTTTGTGTTGAGGCAGTCCAAGAAGAAGGCCGACATCCGGGTCCGCGAA
GGGCGGGCCAAGCCCATCGATCGCCTCACCTTCAGCCTGCGCTACATCGATGCGGACCGCGACGTGTTCGACGAC
GACGAAGGCGACCTGGGAATAGAGCTGCAAGCCCCCGCAGCGGTCGTCGAGGAGCTTGGCGCGGATCAACTCGAC
GAGCTGCAGTCGGACATCGGGACGCTCCTCGTCCTGGAAAGAGACGCCACCAACAGACAGTACTGGGAGGCTCTG
GTGACCCTGTGCAAAGACCGGAAGTCTAAACTCGATCCTCGGAGCCGCGAAGATCGGGTTTTGAGCAGCGTCGCG
GAAGACATCGACAAGATCCTCAAGCCCAAGACGTACGATCAGCTGGAGGCGCTCGAGAAACAGATCGAGGCAAAG
CTGCGATCCAACGAAGACATCGACACGGATTACTGGGAGCAGCTCCTGCGCAACCTGTTGGTCTGGAAGAGCAGG
GCGACGCTGACGCGAATCTTCGAGGCCACCTCGGCGGCCAGGGCCACACTGCTGGAAGGGCGCGAGAAACCTGAC
GAGCCGCAAGCGATGACCGAGCACGCGTCGCTGCTATCGAGCTTCCGGCCGCCCAACGTCGTGACGGGCAACGCC
GCTGGCCCATCGTCGTCGGCGGCGCCAGCAGCAGGGAACGAAGACGTCTCCCAAGCGACAAAGGCCCTCTACGAC
AGAGAGGCGGCCCGCGGCATCTCCGAGAACGAAGAGATCTTCACAGCCGAGGAGGCGGTCCCCGGCCACGCGAAA
CCGCGCTGGACGGACAAGTACAGGGCGAGAAAGCCGCGGTACTTCAACCGGGTGCAGATGGGCTACGAGTGGAAC
AAGTACAACCAGACGCACTACGACCACGATAACCCACCCCCCAAGGTCGTCCAGGGATACAAATTCAACATCTTC
TACCCGGAACTGATCGACAAGACCAAGGCCCCGACCTTCAAGATCATCCGAGAGCACGGACGCAGACGCGGCCAG
TCGCACGCTGCGGCCGGGGAGGCAGACACCTGCCTCATCCACTTCATCTCAGGGCCTCCGTACGAGGATATTGCC
TTTCGCATCGTGGATCGGGAATGGGACTTTAGCGCCAAGAAGGAGCGCGGTTTTCGAAGCACCTTTGACAGAGGA
ATCCTCCAACTGCATTTCCAGTTCAAAAAGATCTTTTATCGAAAATAG
Transcript >Hirsu2|5523
ATGATAGAGAACCAGAAACTCTCCAAAAGCAAAAACATCACGGCCCCGCGAGTTGACCCCAACACCCGAGTCAAC
AAGGCGTCACGGCGAGCCCCCAAAGCGAAGACGGCTCAGAGGGCCTCTAATTACCTCACGCAAGACGAGCAGTCC
CGCCAATTCGTGGCCGACGAGGACAAGTTTGTGTTGAGGCAGTCCAAGAAGAAGGCCGACATCCGGGTCCGCGAA
GGGCGGGCCAAGCCCATCGATCGCCTCACCTTCAGCCTGCGCTACATCGATGCGGACCGCGACGTGTTCGACGAC
GACGAAGGCGACCTGGGAATAGAGCTGCAAGCCCCCGCAGCGGTCGTCGAGGAGCTTGGCGCGGATCAACTCGAC
GAGCTGCAGTCGGACATCGGGACGCTCCTCGTCCTGGAAAGAGACGCCACCAACAGACAGTACTGGGAGGCTCTG
GTGACCCTGTGCAAAGACCGGAAGTCTAAACTCGATCCTCGGAGCCGCGAAGATCGGGTTTTGAGCAGCGTCGCG
GAAGACATCGACAAGATCCTCAAGCCCAAGACGTACGATCAGCTGGAGGCGCTCGAGAAACAGATCGAGGCAAAG
CTGCGATCCAACGAAGACATCGACACGGATTACTGGGAGCAGCTCCTGCGCAACCTGTTGGTCTGGAAGAGCAGG
GCGACGCTGACGCGAATCTTCGAGGCCACCTCGGCGGCCAGGGCCACACTGCTGGAAGGGCGCGAGAAACCTGAC
GAGCCGCAAGCGATGACCGAGCACGCGTCGCTGCTATCGAGCTTCCGGCCGCCCAACGTCGTGACGGGCAACGCC
GCTGGCCCATCGTCGTCGGCGGCGCCAGCAGCAGGGAACGAAGACGTCTCCCAAGCGACAAAGGCCCTCTACGAC
AGAGAGGCGGCCCGCGGCATCTCCGAGAACGAAGAGATCTTCACAGCCGAGGAGGCGGTCCCCGGCCACGCGAAA
CCGCGCTGGACGGACAAGTACAGGGCGAGAAAGCCGCGGTACTTCAACCGGGTGCAGATGGGCTACGAGTGGAAC
AAGTACAACCAGACGCACTACGACCACGATAACCCACCCCCCAAGGTCGTCCAGGGATACAAATTCAACATCTTC
TACCCGGAACTGATCGACAAGACCAAGGCCCCGACCTTCAAGATCATCCGAGAGCACGGACGCAGACGCGGCCAG
TCGCACGCTGCGGCCGGGGAGGCAGACACCTGCCTCATCCACTTCATCTCAGGGCCTCCGTACGAGGATATTGCC
TTTCGCATCGTGGATCGGGAATGGGACTTTAGCGCCAAGAAGGAGCGCGGTTTTCGAAGCACCTTTGACAGAGGA
ATCCTCCAACTGCATTTCCAGTTCAAAAAGATCTTTTATCGAAAATAG
Gene >Hirsu2|5523
ATGATAGAGAACCAGAAACTCTCCAAAAGCAAAAACATCACGGCCCCGCGAGTTGACCCCAACACCCGAGTCAAC
AAGGCGTCACGGCGAGCCCCCAAAGCGAAGACGGCTCAGAGGGCCTCTAATTACCTCACGCAAGACGAGCAGTCC
CGCCAATTCGTGGCCGACGAGGACAAGTTTGTGTTGAGGCAGTCCAAGAAGAAGGCCGACATCCGGGTCCGCGAA
GGGCGGGCCAAGCCCATCGATCGCCTCACCTTCAGCCTGCGCTACATCGATGCGGACCGCGACGTGTTCGACGAC
GACGAAGGCGACCTGGGAATAGAGCTGCAAGCCCCCGCAGCGGTCGTCGAGGAGCTTGGCGCGGATCAACTCGAC
GAGCTGCAGTCGGACATCGGGACGCTCCTCGTCCTGGAAAGAGACGCCACCAACAGACAGTACTGGGAGGCTCTG
GTGACCCTGTGCAAAGACCGGAAGTCTAAACTCGATCCTCGGAGCCGCGAAGATCGGGTTTTGAGCAGCGTCGCG
GAAGACATCGACAAGATCCTCAAGCCCAAGACGTACGATCAGCTGGAGGCGCTCGAGAAACAGATCGAGGCAAAG
CTGCGATCCAACGAAGACATCGACACGGATTACTGGGAGCAGCTCCTGCGCAACCTGTTGGTCTGGAAGAGCAGG
GCGACGCTGACGCGAATCTTCGAGGCCACCTCGGCGGCCAGGGCCACACTGCTGGAAGGGCGCGAGAAACCTGAC
GAGCCGCAAGCGATGACCGAGCACGCGTCGCTGCTATCGAGCTTCCGGCCGCCCAACGTCGTGACGGGCAACGCC
GCTGGCCCATCGTCGTCGGCGGCGCCAGCAGCAGGGAACGAAGACGTCTCCCAAGCGACAAAGGCCCTCTACGAC
AGAGAGGCGGCCCGCGGCATCTCCGAGAACGAAGAGATCTTCACAGCCGAGGAGGCGGTCCCCGGCCACGCGAAA
CCGCGCTGGACGGACAAGTACAGGGCGAGAAAGCCGCGGTACTTCAACCGGGTGCAGATGGGCTACGAGTGGAAC
AAGTACAACCAGACGCACTACGACCACGATAACCCACCCCCCAAGGTCGTCCAGGGATACAAATTCAACATCTTC
TACCCGGAACTGATCGACAAGACCAAGGCCCCGACCTTCAAGATCATCCGAGAGCACGGACGCAGACGCGGCCAG
TCGCACGCTGCGGCCGGGGAGGCAGACACCTGCCTCATCCACTTCATCTCAGGGCCTCCGTACGAGGATATTGCC
TTTCGCATCGTGGATCGGGAATGGGACTTTAGCGCCAAGAAGGAGCGCGGTTTTCGAAGCACCTTTGACAGAGTA
AGTCTTGTTAACAGCCCCCCCGTTTGACCCCTCTGTTTTTTGTTTCCAAAAAAAAAAAAACGTTCCCTCTCCTCG
CTACGTCTGTCCCACGGTCTCTGCTTTCCGTTGCGTTCGAGAGGCGACGAGCAACCCCCCCAAGTTCCTCCCGTT
ACACAAAGGAGCGGGTGCATCTGACAGGCTTCCTTCTGTGCAGGGAATCCTCCAACTGCATTTCCAGTTCAAAAA
GGTGGGTCCTCCATGCACGCCATGCCAGCCCGGTGGCGGCTATGAAGAGACGAAGTAATGACAAGCTACCCCCCA
GATCTTTTATCGAAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail