Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5522
Gene name
LocationContig_277:367..2183
Strand-
Gene length (bp)1816
Transcript length (bp)1725
Coding sequence length (bp)1725
Protein length (aa) 575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00250 Forkhead Forkhead domain 9.2E-20 270 341

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12951|FOXI1_HUMAN Forkhead box protein I1 OS=Homo sapiens GN=FOXI1 PE=1 SV=3 271 382 3.0E-11
sp|Q5A7S7|FKH2_CANAL Fork-head transcriptional regulator 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FKH2 PE=2 SV=1 271 385 8.0E-10
sp|Q6P8A3|FXI1E_XENTR Forkhead box protein I1-ema OS=Xenopus tropicalis GN=foxi1e PE=2 SV=1 271 373 9.0E-10
sp|Q7ZYQ0|FXI1E_XENLA Forkhead box protein I1-ema OS=Xenopus laevis GN=foxi1e PE=2 SV=1 271 373 9.0E-10
sp|Q922I5|FOXI1_MOUSE Forkhead box protein I1 OS=Mus musculus GN=Foxi1 PE=2 SV=2 271 352 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12951|FOXI1_HUMAN Forkhead box protein I1 OS=Homo sapiens GN=FOXI1 PE=1 SV=3 271 382 3.0E-11
sp|Q5A7S7|FKH2_CANAL Fork-head transcriptional regulator 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=FKH2 PE=2 SV=1 271 385 8.0E-10
sp|Q6P8A3|FXI1E_XENTR Forkhead box protein I1-ema OS=Xenopus tropicalis GN=foxi1e PE=2 SV=1 271 373 9.0E-10
sp|Q7ZYQ0|FXI1E_XENLA Forkhead box protein I1-ema OS=Xenopus laevis GN=foxi1e PE=2 SV=1 271 373 9.0E-10
sp|Q922I5|FOXI1_MOUSE Forkhead box protein I1 OS=Mus musculus GN=Foxi1 PE=2 SV=2 271 352 1.0E-09
sp|Q00939|FOXG1_RAT Forkhead box protein G1 OS=Rattus norvegicus GN=Foxg1 PE=2 SV=1 264 382 2.0E-09
sp|Q60987|FOXG1_MOUSE Forkhead box protein G1 OS=Mus musculus GN=Foxg1 PE=2 SV=1 264 382 2.0E-09
sp|Q3I5G5|FOXI2_MOUSE Forkhead box protein I2 OS=Mus musculus GN=Foxi2 PE=2 SV=1 271 352 2.0E-09
sp|Q6ZQN5|FOXI2_HUMAN Forkhead box protein I2 OS=Homo sapiens GN=FOXI2 PE=2 SV=2 271 386 2.0E-09
sp|Q9YHC5|FOXG1_XENLA Forkhead box protein G1 OS=Xenopus laevis GN=foxg1 PE=2 SV=1 264 382 3.0E-09
sp|Q28HT3|FOXI2_XENTR Forkhead box protein I2 OS=Xenopus tropicalis GN=foxi2 PE=2 SV=1 271 379 3.0E-09
sp|O14270|FHL1_SCHPO Fork head transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fhl1 PE=3 SV=2 271 455 4.0E-09
sp|Q90964|FOXG1_CHICK Forkhead box protein G1 OS=Gallus gallus GN=FOXG1 PE=2 SV=1 264 382 4.0E-09
sp|Q8BUR3|FOXJ3_MOUSE Forkhead box protein J3 OS=Mus musculus GN=Foxj3 PE=1 SV=1 264 332 5.0E-09
sp|B5RHS5|FOXI3_CANLF Forkhead box protein I3 OS=Canis lupus familiaris GN=FOXI3 PE=3 SV=1 271 373 6.0E-09
sp|A8MTJ6|FOXI3_HUMAN Forkhead box protein I3 OS=Homo sapiens GN=FOXI3 PE=2 SV=3 271 389 6.0E-09
sp|Q9UPW0|FOXJ3_HUMAN Forkhead box protein J3 OS=Homo sapiens GN=FOXJ3 PE=1 SV=2 264 326 7.0E-09
sp|Q5NDM2|FXI2A_XENLA Forkhead box protein I2-A OS=Xenopus laevis GN=foxi2-a PE=2 SV=1 271 373 9.0E-09
sp|Q91905|FXI1B_XENLA Forkhead box protein I1-B OS=Xenopus laevis GN=foxi1-b PE=2 SV=1 271 382 9.0E-09
sp|Q28D67|FXI1C_XENTR Forkhead box protein I1c OS=Xenopus tropicalis GN=foxi1c PE=2 SV=1 271 352 1.0E-08
sp|O13606|MEI4_SCHPO Meiosis-specific transcription factor mei4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mei4 PE=3 SV=1 271 339 1.0E-08
sp|Q63ZH2|FXI2B_XENLA Forkhead box protein I2-B OS=Xenopus laevis GN=foxi2-b PE=2 SV=2 271 373 1.0E-08
sp|P56260|QIN_AVIS3 Transforming protein Qin OS=Avian sarcoma virus (strain 31) GN=V-QIN PE=2 SV=1 264 382 1.0E-08
sp|Q9P0K8|FOXJ2_HUMAN Forkhead box protein J2 OS=Homo sapiens GN=FOXJ2 PE=1 SV=1 264 339 1.0E-08
sp|Q64731|FOXL1_MOUSE Forkhead box protein L1 OS=Mus musculus GN=Foxl1 PE=2 SV=2 271 463 2.0E-08
sp|Q1A1A4|FOXG1_PIPRU Forkhead box protein G1 OS=Pipistrellus rusticus GN=FOXG1 PE=3 SV=1 271 382 2.0E-08
sp|Q1A1A6|FOXG1_CEBCA Forkhead box protein G1 OS=Cebus capucinus GN=FOXG1 PE=3 SV=1 271 382 2.0E-08
sp|P32030|SLP1_DROME Fork head domain transcription factor slp1 OS=Drosophila melanogaster GN=slp1 PE=2 SV=1 271 377 2.0E-08
sp|Q1A1A2|FOXG1_EQUBU Forkhead box protein G1 OS=Equus burchelli GN=FOXG1 PE=3 SV=1 271 382 2.0E-08
sp|Q1A1A5|FOXG1_CHLPG Forkhead box protein G1 OS=Chlorocebus pygerythrus GN=FOXG1 PE=3 SV=1 271 382 2.0E-08
sp|P55316|FOXG1_HUMAN Forkhead box protein G1 OS=Homo sapiens GN=FOXG1 PE=1 SV=2 271 382 2.0E-08
sp|Q1A1A3|FOXG1_EPOGA Forkhead box protein G1 OS=Epomophorus gambianus GN=FOXG1 PE=3 SV=1 271 382 2.0E-08
sp|Q1A1A1|FOXG1_CERSI Forkhead box protein G1 OS=Ceratotherium simum GN=FOXG1 PE=3 SV=1 271 382 2.0E-08
sp|Q28EM1|FOXJ2_XENTR Forkhead box protein J2 OS=Xenopus tropicalis GN=foxj2 PE=2 SV=1 264 329 2.0E-08
sp|Q9ES18|FOXJ2_MOUSE Forkhead box protein J2 OS=Mus musculus GN=Foxj2 PE=2 SV=1 264 339 2.0E-08
sp|P41813|FKH2_YEAST Fork head protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKH2 PE=1 SV=1 271 332 2.0E-08
sp|O43058|SEP1_SCHPO Forkhead protein sep1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sep1 PE=1 SV=1 251 332 2.0E-08
sp|Q6P2Z3|FOXI1_XENTR Forkhead box protein I1 OS=Xenopus tropicalis GN=foxi1 PE=2 SV=1 271 352 2.0E-08
sp|O60129|FKH2_SCHPO Fork head protein homolog 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fkh2 PE=1 SV=1 271 330 2.0E-08
sp|Q68EZ2|FOXJ2_XENLA Forkhead box protein J2 OS=Xenopus laevis GN=foxj2 PE=2 SV=1 264 329 2.0E-08
sp|Q91904|FXI1A_XENLA Forkhead box protein I1-A OS=Xenopus laevis GN=foxi1-a PE=1 SV=1 271 352 3.0E-08
sp|Q63248|FOXI2_RAT Forkhead box protein I2 (Fragment) OS=Rattus norvegicus GN=Foxi2 PE=2 SV=1 271 352 4.0E-08
sp|Q99958|FOXC2_HUMAN Forkhead box protein C2 OS=Homo sapiens GN=FOXC2 PE=1 SV=1 271 394 4.0E-08
sp|Q61572|FOXC1_MOUSE Forkhead box protein C1 OS=Mus musculus GN=Foxc1 PE=1 SV=3 258 348 4.0E-08
sp|Q8JIT5|FXI1C_XENLA Forkhead box protein I1c OS=Xenopus laevis GN=foxi1c PE=2 SV=1 271 352 5.0E-08
sp|Q3UCQ1|FOXK2_MOUSE Forkhead box protein K2 OS=Mus musculus GN=Foxk2 PE=1 SV=3 248 331 5.0E-08
sp|Q12948|FOXC1_HUMAN Forkhead box protein C1 OS=Homo sapiens GN=FOXC1 PE=1 SV=3 258 348 6.0E-08
sp|Q01167|FOXK2_HUMAN Forkhead box protein K2 OS=Homo sapiens GN=FOXK2 PE=1 SV=3 248 331 7.0E-08
sp|Q61850|FOXC2_MOUSE Forkhead box protein C2 OS=Mus musculus GN=Foxc2 PE=1 SV=2 271 389 7.0E-08
sp|P40466|FKH1_YEAST Fork head protein homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FKH1 PE=1 SV=1 269 349 8.0E-08
sp|Q9WVH3|FOXO4_MOUSE Forkhead box protein O4 OS=Mus musculus GN=Foxo4 PE=1 SV=1 268 330 8.0E-08
sp|P98177|FOXO4_HUMAN Forkhead box protein O4 OS=Homo sapiens GN=FOXO4 PE=1 SV=5 268 330 9.0E-08
sp|Q63246|FOXC2_RAT Forkhead box protein C2 OS=Rattus norvegicus GN=Foxc2 PE=1 SV=2 271 348 1.0E-07
sp|Q7ZX03|FOXK2_XENLA Forkhead box protein K2 OS=Xenopus laevis GN=foxk2 PE=2 SV=2 260 331 1.0E-07
sp|Q6NVT7|FOXC2_XENTR Forkhead box protein C2 OS=Xenopus tropicalis GN=foxc2 PE=2 SV=2 271 348 2.0E-07
sp|P32027|CROC_DROME Fork head domain-containing protein crocodile OS=Drosophila melanogaster GN=croc PE=2 SV=2 250 331 2.0E-07
sp|Q9PVY8|FXC2B_XENLA Forkhead box protein C2-B OS=Xenopus laevis GN=foxc2-b PE=2 SV=2 271 326 2.0E-07
sp|Q12952|FOXL1_HUMAN Forkhead box protein L1 OS=Homo sapiens GN=FOXL1 PE=2 SV=2 271 395 2.0E-07
sp|Q9PVY9|FXC2A_XENLA Forkhead box protein C2-A OS=Xenopus laevis GN=foxc2-a PE=2 SV=1 271 326 2.0E-07
sp|O43638|FOXS1_HUMAN Forkhead box protein S1 OS=Homo sapiens GN=FOXS1 PE=2 SV=2 261 384 2.0E-07
sp|Q5W1J6|FOXM1_XENLA Forkhead box protein M1 OS=Xenopus laevis GN=foxm1 PE=2 SV=1 271 345 2.0E-07
sp|Q02360|FD2_DROME Fork head domain-containing protein FD2 OS=Drosophila melanogaster GN=fd64A PE=2 SV=2 271 408 2.0E-07
sp|Q28F43|FOXN2_XENTR Forkhead box protein N2 OS=Xenopus tropicalis GN=foxn2 PE=2 SV=1 271 329 3.0E-07
sp|Q8ITI5|FOXG1_MNELE Forkhead box protein G1 OS=Mnemiopsis leidyi GN=FOXG1 PE=2 SV=1 256 422 4.0E-07
sp|P23512|FOXA1_RAT Hepatocyte nuclear factor 3-alpha OS=Rattus norvegicus GN=Foxa1 PE=1 SV=1 263 348 4.0E-07
sp|Q32NP8|FXC1B_XENLA Forkhead box protein C1-B OS=Xenopus laevis GN=foxc1-b PE=2 SV=1 258 348 5.0E-07
sp|Q9PVZ3|FXC1A_XENLA Forkhead box protein C1-A OS=Xenopus laevis GN=foxc1-a PE=2 SV=1 258 348 6.0E-07
sp|Q9DE25|FXC1A_DANRE Forkhead box C1-A OS=Danio rerio GN=foxc1a PE=2 SV=1 258 331 6.0E-07
sp|Q9WVH4|FOXO3_MOUSE Forkhead box protein O3 OS=Mus musculus GN=Foxo3 PE=1 SV=1 271 334 7.0E-07
sp|O43524|FOXO3_HUMAN Forkhead box protein O3 OS=Homo sapiens GN=FOXO3 PE=1 SV=1 271 334 7.0E-07
sp|P85037|FOXK1_HUMAN Forkhead box protein K1 OS=Homo sapiens GN=FOXK1 PE=1 SV=1 271 426 7.0E-07
sp|P32314|FOXN2_HUMAN Forkhead box protein N2 OS=Homo sapiens GN=FOXN2 PE=1 SV=3 271 329 7.0E-07
sp|Q66J77|FOXN2_XENLA Forkhead box protein N2 OS=Xenopus laevis GN=foxn2 PE=2 SV=1 271 329 7.0E-07
sp|P32031|SLP2_DROME Fork head domain transcription factor slp2 OS=Drosophila melanogaster GN=slp2 PE=2 SV=2 259 381 1.0E-06
sp|P42128|FOXK1_MOUSE Forkhead box protein K1 OS=Mus musculus GN=Foxk1 PE=1 SV=2 271 368 1.0E-06
sp|Q68F77|FOXC1_XENTR Forkhead box protein C1 OS=Xenopus tropicalis GN=foxc1 PE=2 SV=1 258 348 2.0E-06
sp|O16850|FOXO_CAEEL Forkhead box protein O OS=Caenorhabditis elegans GN=daf-16 PE=1 SV=3 271 400 2.0E-06
sp|P55317|FOXA1_HUMAN Hepatocyte nuclear factor 3-alpha OS=Homo sapiens GN=FOXA1 PE=1 SV=2 263 348 2.0E-06
sp|Q6VFT6|FOXL2_PIG Forkhead box protein L2 OS=Sus scrofa GN=FOXL2 PE=3 SV=1 261 339 3.0E-06
sp|A8MYZ6|FOXO6_HUMAN Forkhead box protein O6 OS=Homo sapiens GN=FOXO6 PE=1 SV=1 271 334 3.0E-06
sp|Q70KY4|FOXO6_MOUSE Forkhead box protein O6 OS=Mus musculus GN=Foxo6 PE=1 SV=1 271 334 3.0E-06
sp|P35582|FOXA1_MOUSE Hepatocyte nuclear factor 3-alpha OS=Mus musculus GN=Foxa1 PE=1 SV=2 263 348 3.0E-06
sp|O88470|FOXL2_MOUSE Forkhead box protein L2 OS=Mus musculus GN=Foxl2 PE=1 SV=2 261 339 4.0E-06
sp|Q6VFT5|FOXL2_RABIT Forkhead box protein L2 OS=Oryctolagus cuniculus GN=FOXL2 PE=3 SV=1 261 339 4.0E-06
sp|P58012|FOXL2_HUMAN Forkhead box protein L2 OS=Homo sapiens GN=FOXL2 PE=1 SV=1 261 339 4.0E-06
sp|Q4VUF1|FOXL2_ELLLU Forkhead box protein L2 OS=Ellobius lutescens GN=FOXL2 PE=3 SV=1 261 339 4.0E-06
sp|Q8MIP2|FOXL2_CAPHI Forkhead box protein L2 OS=Capra hircus GN=FOXL2 PE=1 SV=1 261 339 5.0E-06
sp|Q6VFT7|FOXL2_BOVIN Forkhead box protein L2 OS=Bos taurus GN=FOXL2 PE=2 SV=1 261 339 5.0E-06
sp|Q810W5|FOXO1_ICTTR Forkhead box protein O1 OS=Ictidomys tridecemlineatus GN=FOXO1 PE=1 SV=1 246 334 6.0E-06
sp|A3RK75|FX1AB_DANRE Forkhead box protein O1-B OS=Danio rerio GN=foxo1b PE=2 SV=1 271 334 7.0E-06
sp|Q61080|FOXF1_MOUSE Forkhead box protein F1 OS=Mus musculus GN=Foxf1 PE=2 SV=2 243 326 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0043565 sequence-specific DNA binding Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0097159 organic cyclic compound binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0003677 DNA binding No
GO:0003674 molecular_function No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0009889 regulation of biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0003676 nucleic acid binding No
GO:0010468 regulation of gene expression No
GO:0031326 regulation of cellular biosynthetic process No
GO:0065007 biological regulation No
GO:0031323 regulation of cellular metabolic process No
GO:0140110 transcription regulator activity No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0080090 regulation of primary metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Forkhead

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5522
MNTVFPGGAGTMSPMAALRMEAREHLTETDAILMPSPIVDHRGRASDAGFFSSAAACHHLMPDCQLLPAGPCSDG
YASDGYAFVTAAPPSCVLVKSEQQALPSPPLGPGDFDPAQYCHDLPAPPSAFGVDYPISPMSPDDWPPPVEATAL
LQHHGGKLRSQMAPDRGAEDSMGGMYAATSAPSGNLLPATQQPLGPFSSGYDAAFELSMEHFDPRVLSPEELLIP
FSPPAVTPKLESPPGGLLDMPEAKPESARPLKTGAPGPDGKLDEPYAKLIYRAFMSRPDHAMTLQDIYQWFRDNT
NKAVTEKGGWQNSIRHNLSMNAAFTKRHRKENSGDFRTILEDAKRTNEWVLEDWAVCYGVQSTTRYRKGNSRKRT
GARATSSQPPTRPATRHSAKRAMSGRKGGCAARDSRLRDRACYRRKSTRPGLERGCLSPPRSTGPDMYCPDGFAP
GQIGLAAHERGRPAHRGYGGGGPRPGQALLVREVGYFPLPAEDVIWGQGMANMDEYRGVAGVPSCYGDQASATYG
GPVQDGFPYGGRDVQLAYPYYGHKRVADDGRLPQPATDGLYDWSDSSSS*
Coding >Hirsu2|5522
ATGAACACGGTCTTCCCCGGCGGAGCAGGGACCATGAGCCCCATGGCTGCCCTGCGGATGGAGGCCAGAGAGCAC
TTGACGGAGACGGACGCCATCCTGATGCCTTCCCCCATCGTCGACCACCGCGGACGGGCCTCGGACGCCGGCTTC
TTCTCCTCGGCCGCCGCCTGCCACCACTTGATGCCGGACTGCCAGCTGCTGCCGGCGGGCCCGTGCTCGGACGGC
TACGCCTCGGACGGCTACGCCTTCGTGACGGCGGCGCCCCCGTCGTGCGTGCTGGTCAAGAGCGAGCAGCAGGCG
CTTCCGTCGCCGCCGCTCGGGCCCGGTGACTTCGACCCGGCACAGTACTGCCACGACCTGCCGGCCCCCCCGAGC
GCCTTCGGCGTCGACTATCCCATCTCGCCCATGAGCCCGGACGACTGGCCGCCCCCCGTGGAGGCGACGGCACTC
CTGCAGCACCACGGCGGCAAGCTCCGGAGCCAGATGGCGCCGGACCGCGGCGCCGAGGACTCCATGGGCGGCATG
TACGCGGCGACGTCTGCGCCCAGCGGCAACCTCCTCCCCGCGACCCAGCAGCCCCTCGGCCCCTTCTCGAGCGGC
TACGACGCGGCCTTTGAGCTCTCCATGGAGCACTTCGACCCGCGGGTCCTGTCCCCGGAGGAGCTGCTGATCCCC
TTCTCCCCGCCGGCGGTGACGCCCAAGCTCGAGTCCCCGCCGGGCGGGCTGCTCGACATGCCGGAGGCGAAACCG
GAGTCGGCACGGCCGCTCAAGACGGGGGCACCCGGGCCGGACGGAAAGCTCGACGAGCCGTACGCGAAGCTCATC
TACCGCGCCTTCATGAGCCGGCCGGACCACGCCATGACGCTGCAGGACATCTACCAGTGGTTCCGCGACAACACG
AACAAGGCTGTTACTGAAAAAGGCGGCTGGCAGAACAGCATCCGGCACAATCTGAGCATGAACGCTGCCTTCACC
AAGCGGCACCGGAAGGAGAACAGCGGAGACTTCCGGACGATACTCGAGGACGCCAAGCGGACCAACGAATGGGTG
CTGGAGGACTGGGCCGTGTGCTACGGCGTCCAGAGCACGACGCGGTACCGCAAGGGGAACTCGCGGAAACGCACG
GGGGCGCGGGCGACGTCGAGCCAGCCGCCGACGAGGCCGGCGACCCGCCACAGCGCCAAGCGAGCCATGTCCGGC
CGCAAGGGCGGCTGCGCGGCCAGGGACTCGAGGCTGCGGGACCGGGCCTGCTATCGCAGGAAGTCGACGCGACCC
GGGCTGGAGCGAGGCTGCCTCTCGCCGCCGCGGTCGACGGGGCCAGACATGTACTGCCCCGACGGCTTCGCGCCG
GGCCAGATCGGCTTGGCGGCCCACGAGCGCGGCCGGCCGGCTCACCGGGGTTACGGCGGCGGCGGTCCCAGGCCA
GGCCAGGCGTTGCTGGTGCGCGAGGTCGGCTACTTCCCCCTGCCGGCCGAGGACGTGATTTGGGGGCAAGGCATG
GCCAACATGGACGAGTACCGTGGCGTCGCAGGGGTGCCGTCGTGTTACGGCGACCAGGCCAGCGCCACCTACGGC
GGCCCTGTACAGGACGGCTTCCCGTACGGCGGCCGCGACGTGCAGCTGGCCTACCCCTACTACGGCCACAAGCGC
GTGGCCGACGACGGGAGGCTGCCGCAGCCCGCGACCGACGGCCTCTACGACTGGAGCGACAGCAGCAGCTCCTAA
Transcript >Hirsu2|5522
ATGAACACGGTCTTCCCCGGCGGAGCAGGGACCATGAGCCCCATGGCTGCCCTGCGGATGGAGGCCAGAGAGCAC
TTGACGGAGACGGACGCCATCCTGATGCCTTCCCCCATCGTCGACCACCGCGGACGGGCCTCGGACGCCGGCTTC
TTCTCCTCGGCCGCCGCCTGCCACCACTTGATGCCGGACTGCCAGCTGCTGCCGGCGGGCCCGTGCTCGGACGGC
TACGCCTCGGACGGCTACGCCTTCGTGACGGCGGCGCCCCCGTCGTGCGTGCTGGTCAAGAGCGAGCAGCAGGCG
CTTCCGTCGCCGCCGCTCGGGCCCGGTGACTTCGACCCGGCACAGTACTGCCACGACCTGCCGGCCCCCCCGAGC
GCCTTCGGCGTCGACTATCCCATCTCGCCCATGAGCCCGGACGACTGGCCGCCCCCCGTGGAGGCGACGGCACTC
CTGCAGCACCACGGCGGCAAGCTCCGGAGCCAGATGGCGCCGGACCGCGGCGCCGAGGACTCCATGGGCGGCATG
TACGCGGCGACGTCTGCGCCCAGCGGCAACCTCCTCCCCGCGACCCAGCAGCCCCTCGGCCCCTTCTCGAGCGGC
TACGACGCGGCCTTTGAGCTCTCCATGGAGCACTTCGACCCGCGGGTCCTGTCCCCGGAGGAGCTGCTGATCCCC
TTCTCCCCGCCGGCGGTGACGCCCAAGCTCGAGTCCCCGCCGGGCGGGCTGCTCGACATGCCGGAGGCGAAACCG
GAGTCGGCACGGCCGCTCAAGACGGGGGCACCCGGGCCGGACGGAAAGCTCGACGAGCCGTACGCGAAGCTCATC
TACCGCGCCTTCATGAGCCGGCCGGACCACGCCATGACGCTGCAGGACATCTACCAGTGGTTCCGCGACAACACG
AACAAGGCTGTTACTGAAAAAGGCGGCTGGCAGAACAGCATCCGGCACAATCTGAGCATGAACGCTGCCTTCACC
AAGCGGCACCGGAAGGAGAACAGCGGAGACTTCCGGACGATACTCGAGGACGCCAAGCGGACCAACGAATGGGTG
CTGGAGGACTGGGCCGTGTGCTACGGCGTCCAGAGCACGACGCGGTACCGCAAGGGGAACTCGCGGAAACGCACG
GGGGCGCGGGCGACGTCGAGCCAGCCGCCGACGAGGCCGGCGACCCGCCACAGCGCCAAGCGAGCCATGTCCGGC
CGCAAGGGCGGCTGCGCGGCCAGGGACTCGAGGCTGCGGGACCGGGCCTGCTATCGCAGGAAGTCGACGCGACCC
GGGCTGGAGCGAGGCTGCCTCTCGCCGCCGCGGTCGACGGGGCCAGACATGTACTGCCCCGACGGCTTCGCGCCG
GGCCAGATCGGCTTGGCGGCCCACGAGCGCGGCCGGCCGGCTCACCGGGGTTACGGCGGCGGCGGTCCCAGGCCA
GGCCAGGCGTTGCTGGTGCGCGAGGTCGGCTACTTCCCCCTGCCGGCCGAGGACGTGATTTGGGGGCAAGGCATG
GCCAACATGGACGAGTACCGTGGCGTCGCAGGGGTGCCGTCGTGTTACGGCGACCAGGCCAGCGCCACCTACGGC
GGCCCTGTACAGGACGGCTTCCCGTACGGCGGCCGCGACGTGCAGCTGGCCTACCCCTACTACGGCCACAAGCGC
GTGGCCGACGACGGGAGGCTGCCGCAGCCCGCGACCGACGGCCTCTACGACTGGAGCGACAGCAGCAGCTCCTAA
Gene >Hirsu2|5522
ATGAACACGGTCTTCCCCGGCGGAGCAGGGACCATGAGCCCCATGGCTGCCCTGCGGATGGAGGCCAGAGAGCAC
TTGACGGAGACGGACGCCATCCTGATGCCTTCCCCCATCGTCGACCACCGCGGACGGGCCTCGGACGCCGGCTTC
TTCTCCTCGGCCGCCGCCTGCCACCACTTGATGCCGGACTGCCAGCTGCTGCCGGCGGGCCCGTGCTCGGACGGC
TACGCCTCGGACGGCTACGCCTTCGTGACGGCGGCGCCCCCGTCGTGCGTGCTGGTCAAGAGCGAGCAGCAGGCG
CTTCCGTCGCCGCCGCTCGGGCCCGGTGACTTCGACCCGGCACAGTACTGCCACGACCTGCCGGCCCCCCCGAGC
GCCTTCGGCGTCGACTATCCCATCTCGCCCATGAGCCCGGACGACTGGCCGCCCCCCGTGGAGGCGACGGCACTC
CTGCAGCACCACGGCGGCAAGCTCCGGAGCCAGATGGCGCCGGACCGCGGCGCCGAGGACTCCATGGGCGGCATG
TACGCGGCGACGTCTGCGCCCAGCGGCAACCTCCTCCCCGCGACCCAGCAGCCCCTCGGCCCCTTCTCGAGCGGC
TACGACGCGGCCTTTGAGCTCTCCATGGAGCACTTCGACCCGCGGGTCCTGTCCCCGGAGGAGCTGCTGATCCCC
TTCTCCCCGCCGGCGGTGACGCCCAAGCTCGAGTCCCCGCCGGGCGGGCTGCTCGACATGCCGGAGGCGAAACCG
GAGTCGGCACGGCCGCTCAAGACGGGGGCACCCGGGCCGGACGGAAAGCTCGACGAGCCGTACGCGAAGCTCATC
TACCGCGCCTTCATGAGCCGGCCGGACCACGCCATGACGCTGCAGGACATCTACCAGTGGTTCCGCGACAACACG
AACAAGGCTGTTACTGAAAAAGGCGGCTGGCAGAACAGCATCCGGCACAATCTGAGCATGAACGCTGTAGGTTTC
AAACCCCCCTCTCCTTCTTCTCGATCCATGTCGTCCCATCCCATAGCAAAGCTAACGGCGGGGCGTGCCCGGCCT
CGACCAGGCCTTCACCAAGCGGCACCGGAAGGAGAACAGCGGAGACTTCCGGACGATACTCGAGGACGCCAAGCG
GACCAACGAATGGGTGCTGGAGGACTGGGCCGTGTGCTACGGCGTCCAGAGCACGACGCGGTACCGCAAGGGGAA
CTCGCGGAAACGCACGGGGGCGCGGGCGACGTCGAGCCAGCCGCCGACGAGGCCGGCGACCCGCCACAGCGCCAA
GCGAGCCATGTCCGGCCGCAAGGGCGGCTGCGCGGCCAGGGACTCGAGGCTGCGGGACCGGGCCTGCTATCGCAG
GAAGTCGACGCGACCCGGGCTGGAGCGAGGCTGCCTCTCGCCGCCGCGGTCGACGGGGCCAGACATGTACTGCCC
CGACGGCTTCGCGCCGGGCCAGATCGGCTTGGCGGCCCACGAGCGCGGCCGGCCGGCTCACCGGGGTTACGGCGG
CGGCGGTCCCAGGCCAGGCCAGGCGTTGCTGGTGCGCGAGGTCGGCTACTTCCCCCTGCCGGCCGAGGACGTGAT
TTGGGGGCAAGGCATGGCCAACATGGACGAGTACCGTGGCGTCGCAGGGGTGCCGTCGTGTTACGGCGACCAGGC
CAGCGCCACCTACGGCGGCCCTGTACAGGACGGCTTCCCGTACGGCGGCCGCGACGTGCAGCTGGCCTACCCCTA
CTACGGCCACAAGCGCGTGGCCGACGACGGGAGGCTGCCGCAGCCCGCGACCGACGGCCTCTACGACTGGAGCGA
CAGCAGCAGCTCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail