Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|552
Gene name
LocationContig_1108:973..2240
Strand+
Gene length (bp)1267
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14529 Exo_endo_phos_2 Endonuclease-reverse transcriptase 8.1E-24 224 351

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Extracellular 0.6765 0.4648 0.6773 0.1073 0.052 0.0892 0.1174 0.0296 0.0319 0.004

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup369
Change Orthofinder run
Species Protein ID
Ophiocordyceps kimflemingae Ophio5|941
Ophiocordyceps subramaniannii Hirsu2|10220
Ophiocordyceps subramaniannii Hirsu2|1656
Ophiocordyceps subramaniannii Hirsu2|552 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7707
Ophiocordyceps subramaniannii Hirsu2|7736
Ophiocordyceps subramaniannii Hirsu2|8187
Ophiocordyceps subramaniannii Hirsu2|84
Ophiocordyceps subramaniannii Hirsu2|8425
Ophiocordyceps subramaniannii Hirsu2|8428

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|552
MRDQLYPVKVDNVNRTAVLDGEGNVLPGAVEALGAENNLTIAKISWLSKRETGKAYGSMVVYVTKGSDERRLLDG
QYFDLAGELACTNVFERRNGPVQCFNCQGMGRKAFSCKKPQTCGSALRIFQLNVRKRDTLQLSVLNDADLKDFVV
LGIAEPYARKRDGMIVTAPMGHSNWSRILPTQTNEAGWPVRSMLWVRKDIDLEQVPIPSADLTAAILHLQDRDIL
VASIYVQGKDEEALILAMRELDSLITRFRNGVGKRTDVVLAGDFNRQDLRWGGDSVTSRRQGEAQPIIDLMNEHG
LCSLSPRGTKTWQGADKESTIDLVLTSTELAGDVVKCAVHPTEYGSDHRAIQTVFGINMPERRHTEAPAPERTLD
SNPG*
Coding >Hirsu2|552
ATGAGGGATCAGCTCTACCCGGTCAAGGTCGACAACGTCAACCGCACGGCGGTCCTGGACGGAGAAGGCAACGTT
CTGCCAGGGGCGGTCGAGGCGCTGGGTGCCGAAAATAACCTGACGATTGCCAAAATATCTTGGCTGAGCAAGAGA
GAGACAGGTAAGGCGTATGGGTCGATGGTGGTCTATGTCACGAAAGGCAGCGATGAGAGGAGACTTCTGGATGGG
CAATACTTTGACCTGGCCGGGGAATTGGCCTGCACGAACGTCTTCGAGCGACGCAACGGACCGGTACAGTGCTTC
AACTGTCAAGGGATGGGCCGCAAGGCCTTCTCGTGCAAGAAGCCACAAACTTGCGGCAGTGCGTTACGCATCTTT
CAACTGAACGTACGCAAGCGAGACACACTGCAGCTCAGTGTTCTGAACGACGCGGACTTGAAGGACTTTGTGGTG
CTGGGAATTGCTGAGCCTTACGCGCGCAAGAGGGACGGAATGATCGTGACGGCCCCGATGGGCCACAGCAACTGG
TCAAGGATACTGCCAACGCAGACGAACGAAGCAGGGTGGCCAGTGCGGAGCATGCTCTGGGTGCGGAAGGACATC
GACTTGGAACAGGTACCGATACCATCGGCAGACCTGACAGCCGCCATCCTGCATCTACAAGACAGAGATATCCTT
GTGGCGTCGATATACGTGCAAGGGAAGGACGAGGAGGCGCTGATTCTCGCGATGAGAGAACTCGACAGTCTGATC
ACCCGGTTCCGCAACGGTGTTGGTAAACGAACCGACGTGGTGCTGGCAGGGGATTTCAATCGACAGGACCTGCGC
TGGGGAGGCGACAGCGTGACGTCGAGGAGACAAGGCGAGGCCCAGCCGATCATCGACCTCATGAACGAGCACGGC
CTATGCAGCCTTTCCCCCCGTGGCACGAAGACGTGGCAGGGTGCGGACAAGGAAAGTACAATTGACCTGGTGCTG
ACATCGACGGAACTAGCGGGGGACGTGGTGAAATGTGCGGTGCATCCAACAGAATATGGATCGGACCACCGAGCC
ATCCAGACGGTGTTTGGCATCAATATGCCGGAGAGACGCCACACCGAGGCTCCTGCTCCGGAACGCACCCTGGAC
AGCAATCCGGGATAG
Transcript >Hirsu2|552
ATGAGGGATCAGCTCTACCCGGTCAAGGTCGACAACGTCAACCGCACGGCGGTCCTGGACGGAGAAGGCAACGTT
CTGCCAGGGGCGGTCGAGGCGCTGGGTGCCGAAAATAACCTGACGATTGCCAAAATATCTTGGCTGAGCAAGAGA
GAGACAGGTAAGGCGTATGGGTCGATGGTGGTCTATGTCACGAAAGGCAGCGATGAGAGGAGACTTCTGGATGGG
CAATACTTTGACCTGGCCGGGGAATTGGCCTGCACGAACGTCTTCGAGCGACGCAACGGACCGGTACAGTGCTTC
AACTGTCAAGGGATGGGCCGCAAGGCCTTCTCGTGCAAGAAGCCACAAACTTGCGGCAGTGCGTTACGCATCTTT
CAACTGAACGTACGCAAGCGAGACACACTGCAGCTCAGTGTTCTGAACGACGCGGACTTGAAGGACTTTGTGGTG
CTGGGAATTGCTGAGCCTTACGCGCGCAAGAGGGACGGAATGATCGTGACGGCCCCGATGGGCCACAGCAACTGG
TCAAGGATACTGCCAACGCAGACGAACGAAGCAGGGTGGCCAGTGCGGAGCATGCTCTGGGTGCGGAAGGACATC
GACTTGGAACAGGTACCGATACCATCGGCAGACCTGACAGCCGCCATCCTGCATCTACAAGACAGAGATATCCTT
GTGGCGTCGATATACGTGCAAGGGAAGGACGAGGAGGCGCTGATTCTCGCGATGAGAGAACTCGACAGTCTGATC
ACCCGGTTCCGCAACGGTGTTGGTAAACGAACCGACGTGGTGCTGGCAGGGGATTTCAATCGACAGGACCTGCGC
TGGGGAGGCGACAGCGTGACGTCGAGGAGACAAGGCGAGGCCCAGCCGATCATCGACCTCATGAACGAGCACGGC
CTATGCAGCCTTTCCCCCCGTGGCACGAAGACGTGGCAGGGTGCGGACAAGGAAAGTACAATTGACCTGGTGCTG
ACATCGACGGAACTAGCGGGGGACGTGGTGAAATGTGCGGTGCATCCAACAGAATATGGATCGGACCACCGAGCC
ATCCAGACGGTGTTTGGCATCAATATGCCGGAGAGACGCCACACCGAGGCTCCTGCTCCGGAACGCACCCTGGAC
AGCAATCCGGGATAG
Gene >Hirsu2|552
ATGAGGGATCAGCTCTACCCGGTCAAGGTCGACAACGTCAACCGCACGGCGGTCCTGGACGGAGAAGGCAACGTT
CTGCCAGGGGCGGTCGAGGCGCTGGGTGCCGAAAATAACCTGACGATTGCCAAAATATCTTGGCTGAGCAAGAGA
GAGACAGGTAAGGCGTATGGGTCGATGGTGGTCTATGTCACGAAAGGCAGCGATGAGAGGAGACTTCTGGATGGG
CAATACTTTGACCTGGCCGGGGAATTGGCCTGCACGAACGTCTTCGAGCGACGCAACGGACCGGTACAGTGCTTC
AACTGTCAAGGGATGGGCCGCAAGGCCTTCTCGTGCAAGAAGCCACAAACTTGCGGCAGGTGCGCACAGCAAGGG
CATGGCCACAGGCAGTGCCAGGCTGTGGAGCCGAAATGCGTGCTGTGTGGTGGTCCGCGCGAATCGTTCAGCCAG
AACTGCCGAGTGCGCAACTCACCACGCGATGCGTAGTGCGTTACGCATCTTTCAACTGAACGTACGCAAGCGAGA
CACACTGCAGCTCAGTGTTCTGAACGACGCGGACTTGAAGGACTTTGTGGTGCTGGGAATTGCTGAGCCTTACGC
GCGCAAGAGGGACGGAATGATCGTGACGGCCCCGATGGGCCACAGCAACTGGTCAAGGATACTGCCAACGCAGAC
GAACGAAGCAGGGTGGCCAGTGCGGAGCATGCTCTGGGTGCGGAAGGACATCGACTTGGAACAGGTACCGATACC
ATCGGCAGACCTGACAGCCGCCATCCTGCATCTACAAGACAGAGATATCCTTGTGGCGTCGATATACGTGCAAGG
GAAGGACGAGGAGGCGCTGATTCTCGCGATGAGAGAACTCGACAGTCTGATCACCCGGTTCCGCAACGGTGTTGG
TAAACGAACCGACGTGGTGCTGGCAGGGGATTTCAATCGACAGGACCTGCGCTGGGGAGGCGACAGCGTGACGTC
GAGGAGACAAGGCGAGGCCCAGCCGATCATCGACCTCATGAACGAGCACGGCCTATGCAGCCTTTCCCCCCGTGG
CACGAAGACGTGGCAGGGTGCGGACAAGGAAAGTACAATTGACCTGGTGCTGACATCGACGGAACTAGCGGGGGA
CGTGGTGAAATGTGCGGTGCATCCAACAGAATATGGATCGGACCACCGAGCCATCCAGACGGTGTTTGGCATCAA
TATGCCGGAGAGACGCCACACCGAGGCTCCTGCTCCGGAACGCACCCTGGACAGCAATCCGGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail