Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5516
Gene name
LocationContig_2763:726..1406
Strand+
Gene length (bp)680
Transcript length (bp)492
Coding sequence length (bp)492
Protein length (aa) 164

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01694 Rhomboid Rhomboid family 1.7E-06 24 102

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I4A4|RBD2_GIBZE Rhomboid protein 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RBD2 PE=3 SV=1 1 163 4.0E-76
sp|Q7S4V5|RBD2_NEUCR Rhomboid protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rbd-2 PE=3 SV=1 1 163 5.0E-64
sp|Q874X5|RBD2_PODAS Rhomboid protein 2 OS=Podospora anserina GN=RBD2 PE=3 SV=1 1 163 7.0E-63
sp|Q4WLP9|RBD2_ASPFU Rhomboid protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rbd2 PE=3 SV=1 1 163 9.0E-59
sp|Q6CDV6|RBD2_YARLI Rhomboid protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RBD2 PE=3 SV=1 25 162 2.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I4A4|RBD2_GIBZE Rhomboid protein 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RBD2 PE=3 SV=1 1 163 4.0E-76
sp|Q7S4V5|RBD2_NEUCR Rhomboid protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rbd-2 PE=3 SV=1 1 163 5.0E-64
sp|Q874X5|RBD2_PODAS Rhomboid protein 2 OS=Podospora anserina GN=RBD2 PE=3 SV=1 1 163 7.0E-63
sp|Q4WLP9|RBD2_ASPFU Rhomboid protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rbd2 PE=3 SV=1 1 163 9.0E-59
sp|Q6CDV6|RBD2_YARLI Rhomboid protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RBD2 PE=3 SV=1 25 162 2.0E-15
sp|Q6BSA9|RBD2_DEBHA Rhomboid protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RBD2 PE=3 SV=2 13 118 4.0E-13
sp|Q6CR06|RBD2_KLULA Rhomboid protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RBD2 PE=3 SV=1 6 162 7.0E-09
sp|Q5AH12|RBD2_CANAL Rhomboid protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RBD2 PE=3 SV=1 8 162 3.0E-08
sp|Q12270|RBD2_YEAST Rhomboid protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RBD2 PE=1 SV=1 12 124 1.0E-07
sp|Q6FSG0|RBD2_CANGA Rhomboid protein 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RBD2 PE=3 SV=1 28 133 1.0E-06
sp|Q8LB17|RBL15_ARATH Rhomboid-like protein 15 OS=Arabidopsis thaliana GN=RBL15 PE=1 SV=2 37 115 3.0E-06
sp|Q755H8|RBD2_ASHGO Rhomboid protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RBD2 PE=3 SV=1 19 133 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0004252 serine-type endopeptidase activity Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0140096 catalytic activity, acting on a protein No
GO:0017171 serine hydrolase activity No
GO:0031224 intrinsic component of membrane No
GO:0003674 molecular_function No
GO:0008236 serine-type peptidase activity No
GO:0070011 peptidase activity, acting on L-amino acid peptides No
GO:0044425 membrane part No
GO:0004175 endopeptidase activity No
GO:0003824 catalytic activity No
GO:0008233 peptidase activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 55 77 22
3 81 103 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5516
LFFGPMTTLPAILYLAIEGGILRGNHSVMGASIWVFLLLGMEAIRTYKSNPHLVIGTYYIPTWTSPLLIIIVVAA
LIPNTSLLGHLCGVVVGYIYGLGHLKFMAPPDSTLRWIENRLNLLAILPHYVSIDQKTYGRFGVLPSNNRTGTSA
ATELVGGTRRLGP*
Coding >Hirsu2|5516
CTGTTCTTCGGACCTATGACAACGCTTCCCGCGATACTATATCTGGCTATCGAGGGCGGAATTCTCCGTGGTAAC
CATTCTGTCATGGGAGCTAGTATCTGGGTCTTCCTTCTTCTAGGCATGGAAGCAATTCGAACTTACAAGTCGAAC
CCCCACCTGGTCATAGGCACTTACTATATACCGACATGGACGTCGCCGCTCCTTATTATCATCGTCGTGGCCGCG
CTTATACCAAATACGAGCCTACTCGGACACTTATGCGGCGTGGTTGTTGGATATATATATGGTTTAGGTCACCTG
AAATTCATGGCACCCCCTGACTCGACTTTGCGTTGGATAGAGAACCGCCTGAACCTTTTGGCGATTTTACCGCAT
TACGTGAGCATCGACCAAAAGACGTACGGTCGTTTTGGGGTGTTGCCCTCGAACAATCGCACGGGAACAAGTGCC
GCAACAGAGCTTGTAGGGGGCACTCGCCGTCTCGGCCCTTGA
Transcript >Hirsu2|5516
CTGTTCTTCGGACCTATGACAACGCTTCCCGCGATACTATATCTGGCTATCGAGGGCGGAATTCTCCGTGGTAAC
CATTCTGTCATGGGAGCTAGTATCTGGGTCTTCCTTCTTCTAGGCATGGAAGCAATTCGAACTTACAAGTCGAAC
CCCCACCTGGTCATAGGCACTTACTATATACCGACATGGACGTCGCCGCTCCTTATTATCATCGTCGTGGCCGCG
CTTATACCAAATACGAGCCTACTCGGACACTTATGCGGCGTGGTTGTTGGATATATATATGGTTTAGGTCACCTG
AAATTCATGGCACCCCCTGACTCGACTTTGCGTTGGATAGAGAACCGCCTGAACCTTTTGGCGATTTTACCGCAT
TACGTGAGCATCGACCAAAAGACGTACGGTCGTTTTGGGGTGTTGCCCTCGAACAATCGCACGGGAACAAGTGCC
GCAACAGAGCTTGTAGGGGGCACTCGCCGTCTCGGCCCTTGA
Gene >Hirsu2|5516
CTGTTCTTCGGACGTGAGAATACACAATGCTTTGGGGGCCGGGTGAGAAGTCAGCTGACCAGCTTCCAGCTATGA
CAACGCTTCCCGCGATACTATATCTGGCTATCGAGGGCGGAATTCTCCGTGGTAACCATTCTGTCATGGGAGCTA
GGTGAGAGAGCGTCAATGGAGCGTTGATCGAGACAGCCAGGATGACTGATCTGTCTATTATCTCTAGTATCTGGG
TCTTCCTTCTTCTAGGCATGGAAGCAATTCGAACTTACAAGTCGAACCCCCACCTGGTCATAGGCACTTACTATA
TACCGACATGGACGTCGCCGCTCCTTATTATCATCGTCGTGGCCGCGCTTATACCAAATACGAGCCTACTCGGAC
ACTTATGCGGCGTGGTTGTTGGATATATATGTGAGAGAGCACTGCTTTCATTCTATATTCTACTCGGGGCAATCA
CTCATATATGCCGGCATAAAGATGGTTTAGGTCACCTGAAATTCATGGCACCCCCTGACTCGACTTTGCGTTGGA
TAGAGAACCGCCTGAACCTTTTGGCGATTTTACCGCATTACGTGAGCATCGACCAAAAGACGTACGGTCGTTTTG
GGGTGTTGCCCTCGAACAATCGCACGGGAACAAGTGCCGCAACAGAGCTTGTAGGGGGCACTCGCCGTCTCGGCC
CTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail