Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5507
Gene name
LocationContig_276:7077..9159
Strand+
Gene length (bp)2082
Transcript length (bp)2082
Coding sequence length (bp)2082
Protein length (aa) 694

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07540 NOC3p Nucleolar complex-associated protein 6.5E-31 127 217
PF03914 CBF CBF/Mak21 family 1.1E-24 497 682

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07896|NOC3_YEAST Nucleolar complex-associated protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOC3 PE=1 SV=1 7 693 6.0E-99
sp|O94288|NOC3_SCHPO Nucleolar complex-associated protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=noc3 PE=1 SV=1 43 691 2.0E-82
sp|Q6DRN3|NOC3L_DANRE Nucleolar complex protein 3 homolog OS=Danio rerio GN=noc3l PE=2 SV=1 35 692 4.0E-65
sp|Q91Y26|NOC3L_CRIGR Nucleolar complex protein 3 homolog OS=Cricetulus griseus GN=NOC3L PE=2 SV=1 126 686 6.0E-58
sp|Q8VI84|NOC3L_MOUSE Nucleolar complex protein 3 homolog OS=Mus musculus GN=Noc3l PE=2 SV=2 48 680 9.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07896|NOC3_YEAST Nucleolar complex-associated protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOC3 PE=1 SV=1 7 693 6.0E-99
sp|O94288|NOC3_SCHPO Nucleolar complex-associated protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=noc3 PE=1 SV=1 43 691 2.0E-82
sp|Q6DRN3|NOC3L_DANRE Nucleolar complex protein 3 homolog OS=Danio rerio GN=noc3l PE=2 SV=1 35 692 4.0E-65
sp|Q91Y26|NOC3L_CRIGR Nucleolar complex protein 3 homolog OS=Cricetulus griseus GN=NOC3L PE=2 SV=1 126 686 6.0E-58
sp|Q8VI84|NOC3L_MOUSE Nucleolar complex protein 3 homolog OS=Mus musculus GN=Noc3l PE=2 SV=2 48 680 9.0E-58
sp|Q5R952|NOC3L_PONAB Nucleolar complex protein 3 homolog OS=Pongo abelii GN=NOC3L PE=2 SV=1 126 686 1.0E-57
sp|Q8WTT2|NOC3L_HUMAN Nucleolar complex protein 3 homolog OS=Homo sapiens GN=NOC3L PE=1 SV=1 126 680 5.0E-57
sp|Q5XGZ8|NOC3L_XENLA Nucleolar complex protein 3 homolog OS=Xenopus laevis GN=noc3l PE=2 SV=1 128 680 2.0E-49
sp|Q9VI82|NOC3L_DROME Nucleolar complex protein 3 homolog OS=Drosophila melanogaster GN=CG1234 PE=1 SV=1 122 680 2.0E-34
sp|Q61LN7|NOC3L_CAEBR Nucleolar complex protein 3 homolog OS=Caenorhabditis briggsae GN=CBG08826 PE=3 SV=1 90 665 2.0E-26
sp|P91136|NOC3L_CAEEL Nucleolar complex protein 3 homolog OS=Caenorhabditis elegans GN=C37H5.5 PE=3 SV=3 126 665 2.0E-25
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5507
MSSNGHKRRKVAHNSSDDEGQQRQRSKQTQKDFFKHASNWNLEQDYELRRRKSKKKAKESTKLPQIKTTDGRVEI
LQSLQTEDDAGSVASDDDWLDGREDELEPEPDRAEEAEAEDERPEDQQVLEAKEELAKLATAVNEKPEANAGALK
ALAKIGQSRVPAVQMLALLTQMAVYKDIIPGYRIRPLSEEAQKEKVSKEVRRMRQFEQALVHGYQGYVRELARCA
KAAAPRPPPPPGGQSLASVAVSCACALVTAVPHFNFRSDLLQILVGRLSRRAGAANDEAAARCRGALETLFRDDD
EGRPSFEAVSLLAKMMRARDFDVDERVLDLFLSLRLLSEFAGTASGDRVERRPDGGRPPETPRKKAKREFRTKRE
RKALKEQKALDRDMAQADALVSHEERERMQSETLKLVFATYFRILKLRLPRLMGAVLEGLARYAHLINQDFFGDL
LEALKDLIRHSDDDADAGPADDVGGGDDDDDGTRRHASCRNLTREALLCTVTAFALLAGQDAHNARRELHLDLSF
FTVHLFRSLLSLSTDPDLENSGPSASSSSSSSSSSSSSSVNFQTTTVLLIRSLTGVLLPPWNIRQVPPLRLAAFT
KQLMTAALQLPDRSAQAVLALVADVAATHSAKVASLWHTEERKGDGAFNALSETVEGSNPLASTVWEGELLRRHY
SPKVREAVKMLEKSVSSR*
Coding >Hirsu2|5507
ATGAGCTCCAATGGGCACAAGAGGCGAAAGGTAGCGCACAACTCGTCGGACGACGAGGGGCAGCAGCGGCAACGA
TCCAAACAGACGCAAAAGGACTTCTTCAAGCACGCGTCCAACTGGAACCTGGAGCAGGACTACGAGCTGAGGCGG
CGGAAGAGCAAGAAGAAGGCCAAGGAGAGCACCAAGCTGCCGCAGATCAAGACGACCGACGGCCGGGTCGAGATC
CTGCAGAGCCTGCAGACCGAGGACGATGCCGGCTCGGTAGCCAGCGACGACGACTGGCTCGACGGCCGCGAGGAC
GAGCTCGAGCCTGAGCCGGACCGGGCCGAGGAGGCCGAGGCCGAGGACGAGAGGCCCGAGGACCAGCAGGTGCTG
GAGGCGAAGGAGGAGCTGGCCAAGCTGGCGACGGCCGTCAACGAGAAGCCCGAGGCGAACGCGGGCGCGCTCAAG
GCGCTGGCCAAGATCGGCCAGTCGCGGGTCCCCGCCGTCCAGATGCTGGCGCTCCTGACGCAGATGGCCGTCTAT
AAGGACATCATCCCCGGGTACCGGATCCGGCCGCTGTCCGAGGAGGCGCAGAAAGAGAAGGTCTCCAAGGAGGTG
CGCCGGATGCGGCAGTTCGAGCAGGCGCTCGTCCACGGCTACCAAGGCTACGTCCGCGAGCTGGCGCGGTGCGCT
AAGGCCGCCGCGCCCCGCCCGCCGCCGCCGCCCGGCGGACAGAGCCTGGCCAGCGTGGCCGTCAGCTGCGCTTGC
GCCCTCGTCACGGCCGTGCCGCACTTCAACTTCCGCTCCGACCTGCTCCAGATCCTGGTCGGGCGGCTGAGCCGG
CGCGCGGGGGCCGCCAACGACGAGGCGGCGGCCCGGTGCCGGGGCGCGCTCGAGACGCTGTTCCGCGACGACGAC
GAGGGTCGGCCCTCGTTCGAGGCCGTCTCGCTCCTGGCCAAGATGATGCGCGCGCGCGACTTCGACGTCGACGAG
CGCGTCCTCGACCTCTTCCTCAGCCTGCGCCTGCTGTCCGAGTTCGCCGGCACCGCGTCCGGCGACCGGGTCGAG
CGCCGGCCGGACGGCGGCCGCCCCCCGGAGACGCCGAGGAAGAAGGCCAAACGCGAGTTCCGCACCAAGCGCGAG
CGGAAGGCGCTCAAGGAGCAGAAGGCGCTGGACCGCGACATGGCCCAGGCCGACGCCCTCGTCAGCCACGAGGAA
CGCGAGCGGATGCAGTCCGAGACGCTCAAGCTCGTCTTCGCCACCTACTTCCGCATCTTGAAGCTGCGCCTGCCG
CGCCTCATGGGCGCAGTCCTCGAAGGCCTCGCCCGCTACGCCCATCTCATCAACCAGGACTTCTTCGGCGACCTG
CTCGAGGCGCTCAAGGACCTGATCCGTCACAGCGACGACGATGCCGACGCCGGCCCGGCCGACGACGTCGGCGGC
GGTGACGACGACGACGACGGGACGCGGCGTCACGCATCCTGCCGAAACCTGACTCGCGAGGCCCTCCTCTGCACC
GTCACGGCCTTCGCCCTCCTCGCCGGTCAGGACGCCCACAACGCCCGCCGCGAGCTGCACCTCGACCTGTCCTTC
TTCACCGTCCACCTCTTCAGAAGCCTCCTGTCGCTCTCGACGGATCCAGACCTCGAGAACAGCGGCCCGTCCGCC
TCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCAGTGTCAACTTCCAGACGACGACGGTGCTGCTCATC
CGCTCCCTGACGGGCGTCCTGCTGCCACCCTGGAACATACGCCAGGTTCCGCCCCTGCGCCTCGCCGCCTTCACC
AAGCAGCTCATGACGGCCGCCCTGCAGCTGCCCGACCGCTCGGCCCAGGCCGTCCTGGCCCTCGTTGCCGACGTC
GCCGCCACCCATTCCGCCAAAGTTGCCAGCTTGTGGCACACCGAGGAGCGCAAGGGCGACGGCGCCTTCAACGCC
CTCAGCGAGACCGTCGAGGGCAGCAACCCCCTCGCCTCCACCGTCTGGGAGGGCGAGCTGCTGAGGAGGCACTAC
TCGCCCAAGGTCAGGGAGGCCGTCAAGATGCTGGAGAAGAGCGTGTCGTCAAGGTGA
Transcript >Hirsu2|5507
ATGAGCTCCAATGGGCACAAGAGGCGAAAGGTAGCGCACAACTCGTCGGACGACGAGGGGCAGCAGCGGCAACGA
TCCAAACAGACGCAAAAGGACTTCTTCAAGCACGCGTCCAACTGGAACCTGGAGCAGGACTACGAGCTGAGGCGG
CGGAAGAGCAAGAAGAAGGCCAAGGAGAGCACCAAGCTGCCGCAGATCAAGACGACCGACGGCCGGGTCGAGATC
CTGCAGAGCCTGCAGACCGAGGACGATGCCGGCTCGGTAGCCAGCGACGACGACTGGCTCGACGGCCGCGAGGAC
GAGCTCGAGCCTGAGCCGGACCGGGCCGAGGAGGCCGAGGCCGAGGACGAGAGGCCCGAGGACCAGCAGGTGCTG
GAGGCGAAGGAGGAGCTGGCCAAGCTGGCGACGGCCGTCAACGAGAAGCCCGAGGCGAACGCGGGCGCGCTCAAG
GCGCTGGCCAAGATCGGCCAGTCGCGGGTCCCCGCCGTCCAGATGCTGGCGCTCCTGACGCAGATGGCCGTCTAT
AAGGACATCATCCCCGGGTACCGGATCCGGCCGCTGTCCGAGGAGGCGCAGAAAGAGAAGGTCTCCAAGGAGGTG
CGCCGGATGCGGCAGTTCGAGCAGGCGCTCGTCCACGGCTACCAAGGCTACGTCCGCGAGCTGGCGCGGTGCGCT
AAGGCCGCCGCGCCCCGCCCGCCGCCGCCGCCCGGCGGACAGAGCCTGGCCAGCGTGGCCGTCAGCTGCGCTTGC
GCCCTCGTCACGGCCGTGCCGCACTTCAACTTCCGCTCCGACCTGCTCCAGATCCTGGTCGGGCGGCTGAGCCGG
CGCGCGGGGGCCGCCAACGACGAGGCGGCGGCCCGGTGCCGGGGCGCGCTCGAGACGCTGTTCCGCGACGACGAC
GAGGGTCGGCCCTCGTTCGAGGCCGTCTCGCTCCTGGCCAAGATGATGCGCGCGCGCGACTTCGACGTCGACGAG
CGCGTCCTCGACCTCTTCCTCAGCCTGCGCCTGCTGTCCGAGTTCGCCGGCACCGCGTCCGGCGACCGGGTCGAG
CGCCGGCCGGACGGCGGCCGCCCCCCGGAGACGCCGAGGAAGAAGGCCAAACGCGAGTTCCGCACCAAGCGCGAG
CGGAAGGCGCTCAAGGAGCAGAAGGCGCTGGACCGCGACATGGCCCAGGCCGACGCCCTCGTCAGCCACGAGGAA
CGCGAGCGGATGCAGTCCGAGACGCTCAAGCTCGTCTTCGCCACCTACTTCCGCATCTTGAAGCTGCGCCTGCCG
CGCCTCATGGGCGCAGTCCTCGAAGGCCTCGCCCGCTACGCCCATCTCATCAACCAGGACTTCTTCGGCGACCTG
CTCGAGGCGCTCAAGGACCTGATCCGTCACAGCGACGACGATGCCGACGCCGGCCCGGCCGACGACGTCGGCGGC
GGTGACGACGACGACGACGGGACGCGGCGTCACGCATCCTGCCGAAACCTGACTCGCGAGGCCCTCCTCTGCACC
GTCACGGCCTTCGCCCTCCTCGCCGGTCAGGACGCCCACAACGCCCGCCGCGAGCTGCACCTCGACCTGTCCTTC
TTCACCGTCCACCTCTTCAGAAGCCTCCTGTCGCTCTCGACGGATCCAGACCTCGAGAACAGCGGCCCGTCCGCC
TCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCAGTGTCAACTTCCAGACGACGACGGTGCTGCTCATC
CGCTCCCTGACGGGCGTCCTGCTGCCACCCTGGAACATACGCCAGGTTCCGCCCCTGCGCCTCGCCGCCTTCACC
AAGCAGCTCATGACGGCCGCCCTGCAGCTGCCCGACCGCTCGGCCCAGGCCGTCCTGGCCCTCGTTGCCGACGTC
GCCGCCACCCATTCCGCCAAAGTTGCCAGCTTGTGGCACACCGAGGAGCGCAAGGGCGACGGCGCCTTCAACGCC
CTCAGCGAGACCGTCGAGGGCAGCAACCCCCTCGCCTCCACCGTCTGGGAGGGCGAGCTGCTGAGGAGGCACTAC
TCGCCCAAGGTCAGGGAGGCCGTCAAGATGCTGGAGAAGAGCGTGTCGTCAAGGTGA
Gene >Hirsu2|5507
ATGAGCTCCAATGGGCACAAGAGGCGAAAGGTAGCGCACAACTCGTCGGACGACGAGGGGCAGCAGCGGCAACGA
TCCAAACAGACGCAAAAGGACTTCTTCAAGCACGCGTCCAACTGGAACCTGGAGCAGGACTACGAGCTGAGGCGG
CGGAAGAGCAAGAAGAAGGCCAAGGAGAGCACCAAGCTGCCGCAGATCAAGACGACCGACGGCCGGGTCGAGATC
CTGCAGAGCCTGCAGACCGAGGACGATGCCGGCTCGGTAGCCAGCGACGACGACTGGCTCGACGGCCGCGAGGAC
GAGCTCGAGCCTGAGCCGGACCGGGCCGAGGAGGCCGAGGCCGAGGACGAGAGGCCCGAGGACCAGCAGGTGCTG
GAGGCGAAGGAGGAGCTGGCCAAGCTGGCGACGGCCGTCAACGAGAAGCCCGAGGCGAACGCGGGCGCGCTCAAG
GCGCTGGCCAAGATCGGCCAGTCGCGGGTCCCCGCCGTCCAGATGCTGGCGCTCCTGACGCAGATGGCCGTCTAT
AAGGACATCATCCCCGGGTACCGGATCCGGCCGCTGTCCGAGGAGGCGCAGAAAGAGAAGGTCTCCAAGGAGGTG
CGCCGGATGCGGCAGTTCGAGCAGGCGCTCGTCCACGGCTACCAAGGCTACGTCCGCGAGCTGGCGCGGTGCGCT
AAGGCCGCCGCGCCCCGCCCGCCGCCGCCGCCCGGCGGACAGAGCCTGGCCAGCGTGGCCGTCAGCTGCGCTTGC
GCCCTCGTCACGGCCGTGCCGCACTTCAACTTCCGCTCCGACCTGCTCCAGATCCTGGTCGGGCGGCTGAGCCGG
CGCGCGGGGGCCGCCAACGACGAGGCGGCGGCCCGGTGCCGGGGCGCGCTCGAGACGCTGTTCCGCGACGACGAC
GAGGGTCGGCCCTCGTTCGAGGCCGTCTCGCTCCTGGCCAAGATGATGCGCGCGCGCGACTTCGACGTCGACGAG
CGCGTCCTCGACCTCTTCCTCAGCCTGCGCCTGCTGTCCGAGTTCGCCGGCACCGCGTCCGGCGACCGGGTCGAG
CGCCGGCCGGACGGCGGCCGCCCCCCGGAGACGCCGAGGAAGAAGGCCAAACGCGAGTTCCGCACCAAGCGCGAG
CGGAAGGCGCTCAAGGAGCAGAAGGCGCTGGACCGCGACATGGCCCAGGCCGACGCCCTCGTCAGCCACGAGGAA
CGCGAGCGGATGCAGTCCGAGACGCTCAAGCTCGTCTTCGCCACCTACTTCCGCATCTTGAAGCTGCGCCTGCCG
CGCCTCATGGGCGCAGTCCTCGAAGGCCTCGCCCGCTACGCCCATCTCATCAACCAGGACTTCTTCGGCGACCTG
CTCGAGGCGCTCAAGGACCTGATCCGTCACAGCGACGACGATGCCGACGCCGGCCCGGCCGACGACGTCGGCGGC
GGTGACGACGACGACGACGGGACGCGGCGTCACGCATCCTGCCGAAACCTGACTCGCGAGGCCCTCCTCTGCACC
GTCACGGCCTTCGCCCTCCTCGCCGGTCAGGACGCCCACAACGCCCGCCGCGAGCTGCACCTCGACCTGTCCTTC
TTCACCGTCCACCTCTTCAGAAGCCTCCTGTCGCTCTCGACGGATCCAGACCTCGAGAACAGCGGCCCGTCCGCC
TCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCAGTGTCAACTTCCAGACGACGACGGTGCTGCTCATC
CGCTCCCTGACGGGCGTCCTGCTGCCACCCTGGAACATACGCCAGGTTCCGCCCCTGCGCCTCGCCGCCTTCACC
AAGCAGCTCATGACGGCCGCCCTGCAGCTGCCCGACCGCTCGGCCCAGGCCGTCCTGGCCCTCGTTGCCGACGTC
GCCGCCACCCATTCCGCCAAAGTTGCCAGCTTGTGGCACACCGAGGAGCGCAAGGGCGACGGCGCCTTCAACGCC
CTCAGCGAGACCGTCGAGGGCAGCAACCCCCTCGCCTCCACCGTCTGGGAGGGCGAGCTGCTGAGGAGGCACTAC
TCGCCCAAGGTCAGGGAGGCCGTCAAGATGCTGGAGAAGAGCGTGTCGTCAAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail