Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5505
Gene name
LocationContig_276:3976..5219
Strand+
Gene length (bp)1243
Transcript length (bp)1071
Coding sequence length (bp)1071
Protein length (aa) 357

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1JQ66|S35E3_DANRE Solute carrier family 35 member E3 OS=Danio rerio GN=slc35e3 PE=2 SV=1 56 344 1.0E-41
sp|Q7Z769|S35E3_HUMAN Solute carrier family 35 member E3 OS=Homo sapiens GN=SLC35E3 PE=2 SV=1 55 344 7.0E-40
sp|A4IFK2|S35E3_BOVIN Solute carrier family 35 member E3 OS=Bos taurus GN=SLC35E3 PE=2 SV=1 55 354 1.0E-38
sp|Q6PGC7|S35E3_MOUSE Solute carrier family 35 member E3 OS=Mus musculus GN=Slc35e3 PE=2 SV=1 55 344 1.0E-37
sp|Q8RXL8|Y1689_ARATH Uncharacterized membrane protein At1g06890 OS=Arabidopsis thaliana GN=At1g06890 PE=1 SV=1 72 344 9.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1JQ66|S35E3_DANRE Solute carrier family 35 member E3 OS=Danio rerio GN=slc35e3 PE=2 SV=1 56 344 1.0E-41
sp|Q7Z769|S35E3_HUMAN Solute carrier family 35 member E3 OS=Homo sapiens GN=SLC35E3 PE=2 SV=1 55 344 7.0E-40
sp|A4IFK2|S35E3_BOVIN Solute carrier family 35 member E3 OS=Bos taurus GN=SLC35E3 PE=2 SV=1 55 354 1.0E-38
sp|Q6PGC7|S35E3_MOUSE Solute carrier family 35 member E3 OS=Mus musculus GN=Slc35e3 PE=2 SV=1 55 344 1.0E-37
sp|Q8RXL8|Y1689_ARATH Uncharacterized membrane protein At1g06890 OS=Arabidopsis thaliana GN=At1g06890 PE=1 SV=1 72 344 9.0E-28
sp|Q9SRE4|UGAL2_ARATH UDP-galactose transporter 2 OS=Arabidopsis thaliana GN=UDP-GALT2 PE=2 SV=1 41 344 6.0E-19
sp|Q550W6|FUCT1_DICDI GDP-fucose transporter 1 OS=Dictyostelium discoideum GN=slc35c1 PE=3 SV=1 46 345 1.0E-12
sp|Q9SFE9|GONS5_ARATH GDP-mannose transporter GONST5 OS=Arabidopsis thaliana GN=GONST5 PE=2 SV=1 49 346 3.0E-10
sp|Q9C521|UGAL1_ARATH UDP-galactose transporter 1 OS=Arabidopsis thaliana GN=UDP-GALT1 PE=2 SV=1 49 346 2.0E-09
sp|A9UUB8|FUCT1_MONBE GDP-fucose transporter 1 OS=Monosiga brevicollis GN=slc35c1 PE=3 SV=1 65 311 5.0E-08
sp|A7S1L6|FUCT1_NEMVE GDP-fucose transporter 1 OS=Nematostella vectensis GN=slc35c1 PE=3 SV=1 65 311 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

Domain # Start End Length
1 51 70 19
2 83 105 22
3 125 147 22
4 168 190 22
5 205 227 22
6 240 258 18
7 273 295 22
8 329 348 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5505
MSSLLPPPRAEPDAVSPAESKEKMSLPATDDSVEAALILLPPLSDPKPQSLAAAAAWMSVNTLATIGIVFTNKAI
FSDPSWTLSQLSFASFHFLVTWATLFVMSRPTFACFAPRRASIQHLLPLALAMSLNVILPNLSLAFSSVTFYQLA
RILLTPTVALMNFVLYRAALPTLAIVALVPACLGVGIVSYYDSLPTSNSSIKTTSPLGIVFAFLGILASSLYTVW
IASYHRKLQMNSMQLLYNQAPIAAFMLLYAIPFLDTVPDLTRVSASKWLTIALSGLFASLINMSQFFIVVQTGPV
SSTVVGHVKTCTIVCIGWVMSGRPVGDRALVGVVVAVAAVVAYSIVMLEHNARKLG*
Coding >Hirsu2|5505
ATGAGCTCACTTCTCCCGCCACCTCGCGCCGAGCCCGACGCCGTTTCGCCGGCAGAGAGCAAGGAGAAGATGAGC
TTGCCGGCGACCGACGACAGTGTCGAGGCCGCTCTGATTCTTCTCCCGCCGCTGTCCGATCCGAAACCCCAAAGC
TTGGCGGCGGCAGCTGCTTGGATGAGCGTCAACACGCTGGCGACGATTGGAATTGTCTTCACCAACAAGGCCATC
TTTTCCGATCCTTCCTGGACGCTGTCCCAGCTATCCTTCGCCTCCTTTCACTTCCTCGTCACCTGGGCCACCCTC
TTCGTCATGTCGAGGCCGACCTTTGCCTGCTTTGCTCCCCGCCGCGCCTCCATCCAGCACCTGCTCCCTCTCGCC
CTTGCCATGAGCCTCAACGTCATCCTTCCCAATCTCTCCTTGGCCTTCTCCTCCGTCACCTTCTACCAGCTGGCC
CGCATCCTGCTCACCCCAACCGTTGCCCTGATGAACTTCGTCCTGTACCGAGCAGCTCTGCCGACGCTCGCCATC
GTCGCCCTCGTCCCGGCCTGTCTGGGCGTCGGCATCGTCTCGTACTACGACTCCCTCCCGACGTCCAATTCCAGC
ATCAAGACAACATCGCCCCTCGGCATTGTCTTTGCCTTCCTTGGCATCCTGGCCTCCTCTCTCTACACCGTCTGG
ATCGCCAGCTATCACCGAAAGCTGCAGATGAATAGCATGCAGCTCCTCTACAACCAGGCACCAATTGCCGCATTC
ATGCTTCTATACGCCATACCCTTCCTCGATACAGTCCCTGATCTGACCCGCGTTTCCGCGAGCAAATGGCTGACG
ATTGCTCTGTCCGGACTTTTCGCCTCCCTCATCAACATGTCTCAGTTTTTTATTGTAGTCCAGACGGGCCCGGTC
TCAAGCACCGTCGTGGGACACGTCAAGACCTGTACCATCGTGTGCATTGGATGGGTCATGTCAGGCCGACCCGTG
GGCGACAGGGCCTTGGTCGGGGTAGTGGTAGCCGTCGCCGCAGTCGTCGCATACTCCATTGTCATGTTGGAGCAC
AACGCGCGCAAACTCGGGTAG
Transcript >Hirsu2|5505
ATGAGCTCACTTCTCCCGCCACCTCGCGCCGAGCCCGACGCCGTTTCGCCGGCAGAGAGCAAGGAGAAGATGAGC
TTGCCGGCGACCGACGACAGTGTCGAGGCCGCTCTGATTCTTCTCCCGCCGCTGTCCGATCCGAAACCCCAAAGC
TTGGCGGCGGCAGCTGCTTGGATGAGCGTCAACACGCTGGCGACGATTGGAATTGTCTTCACCAACAAGGCCATC
TTTTCCGATCCTTCCTGGACGCTGTCCCAGCTATCCTTCGCCTCCTTTCACTTCCTCGTCACCTGGGCCACCCTC
TTCGTCATGTCGAGGCCGACCTTTGCCTGCTTTGCTCCCCGCCGCGCCTCCATCCAGCACCTGCTCCCTCTCGCC
CTTGCCATGAGCCTCAACGTCATCCTTCCCAATCTCTCCTTGGCCTTCTCCTCCGTCACCTTCTACCAGCTGGCC
CGCATCCTGCTCACCCCAACCGTTGCCCTGATGAACTTCGTCCTGTACCGAGCAGCTCTGCCGACGCTCGCCATC
GTCGCCCTCGTCCCGGCCTGTCTGGGCGTCGGCATCGTCTCGTACTACGACTCCCTCCCGACGTCCAATTCCAGC
ATCAAGACAACATCGCCCCTCGGCATTGTCTTTGCCTTCCTTGGCATCCTGGCCTCCTCTCTCTACACCGTCTGG
ATCGCCAGCTATCACCGAAAGCTGCAGATGAATAGCATGCAGCTCCTCTACAACCAGGCACCAATTGCCGCATTC
ATGCTTCTATACGCCATACCCTTCCTCGATACAGTCCCTGATCTGACCCGCGTTTCCGCGAGCAAATGGCTGACG
ATTGCTCTGTCCGGACTTTTCGCCTCCCTCATCAACATGTCTCAGTTTTTTATTGTAGTCCAGACGGGCCCGGTC
TCAAGCACCGTCGTGGGACACGTCAAGACCTGTACCATCGTGTGCATTGGATGGGTCATGTCAGGCCGACCCGTG
GGCGACAGGGCCTTGGTCGGGGTAGTGGTAGCCGTCGCCGCAGTCGTCGCATACTCCATTGTCATGTTGGAGCAC
AACGCGCGCAAACTCGGGTAG
Gene >Hirsu2|5505
ATGAGCTCACTTCTCCCGCCACCTCGCGCCGAGCCCGACGCCGTTTCGCCGGCAGAGAGCAAGGAGAAGATGAGC
TTGCCGGCGACCGACGACAGTGTCGAGGCCGCTCTGATTCTTCTCCCGCCGCTGTCCGATCCGAAACCCCAAAGC
TTGGCGGCGGCAGCTGCTTGGATGAGCGTCAACACGCTGGCGACGATTGGAATTGTACGCCCCTTTCTTGGCCCG
ACATGCACCCTCGCTCACCGGCCATCCGGCAGGTCTTCACCAACAAGGCCATCTTTTCCGATCCTTCCTGGACGC
TGTCCCAGCTATCCTTCGCCTCCTTTCACTTCCTCGTCACCTGGGCCACCCTCTTCGTCATGTCGAGGCCGACCT
TTGCCTGCTTTGCTCCCCGCCGCGCCTCCATCCAGCACCTGCTCCCTCTCGCCCTTGCCATGAGCCTCAACGTCA
TCCTTCCCAATCTCTCCTTGGCCTTCTCCTCCGTCACCTTCTACCAGCTGGCCCGCATCCTGCTCACCCCAACCG
TTGCCCTGATGAACTTCGTCCTGTACCGAGCAGCTCTGCCGACGCTCGCCATCGTCGCCCTCGTCCCGGCCTGTC
TGGGCGTCGGCATCGTCTCGTACTACGACTCCCTCCCGACGTCCAATTCCAGCATCAAGACAACATCGCCCCTCG
GCATTGTCTTTGCCTTCCTTGGCATCCTGGCCTCCTCTCTCTACACCGTCTGGATCGCCAGCTATCACCGAAAGC
TGCAGATGAATAGCATGCAGCTCCTCTACAACCAGGCACCAATTGCCGCATTCATGCTTCTATACGCCATACCCT
TCCTCGATACAGTCCCTGATCTGACCCGCGTTTCCGCGAGCAAATGGCTGACGATTGCTCTGGTGCGTCGATCCG
TCAACCCTCGACTGCAGCTTCTGACGACTTCAAGTCCGGACTTTTCGCCTCCCTCATCAACATGTCTCAGTTTTT
TATTGTAGTCCAGACGGGCCCGGTCTCAAGCACCGTCGTGGGACACGTCAAGACCTGTACCATCGTGTGCATTGG
ATGGGTCATGTCAGGCCGACCCGTGGGCGACAGGGCCTTGGTCGGGGTAGTGGTAGCCGTCGCCGCAGTCGTCGC
GTGAGTTTCATTGCGTTCTGTCCCCCACAGCTTGTCCCCATCTCAGTGGGCGATTGCTCACCTACGACGCAGATA
CTCCATTGTCATGTTGGAGCACAACGCGCGCAAACTCGGGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail