Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5504
Gene name
LocationContig_276:1135..2696
Strand-
Gene length (bp)1561
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase 6.1E-68 103 411
PF01370 Epimerase NAD dependent epimerase/dehydratase family 3.0E-56 102 343
PF02719 Polysacc_synt_2 Polysaccharide biosynthesis protein 3.6E-21 102 371
PF01073 3Beta_HSD 3-beta hydroxysteroid dehydrogenase/isomerase family 1.5E-19 103 326
PF04321 RmlD_sub_bind RmlD substrate binding domain 8.3E-19 101 367
PF07993 NAD_binding_4 Male sterility protein 6.3E-17 104 283

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O95455|TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=TGDS PE=1 SV=1 100 437 1.0E-105
sp|A6QLW2|TGDS_BOVIN dTDP-D-glucose 4,6-dehydratase OS=Bos taurus GN=TGDS PE=2 SV=1 95 437 3.0E-105
sp|Q9LH76|RHM3_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3 OS=Arabidopsis thaliana GN=RHM3 PE=1 SV=1 100 436 2.0E-104
sp|Q8VDR7|TGDS_MOUSE dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=Tgds PE=2 SV=2 100 437 2.0E-103
sp|Q9LPG6|RHM2_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2 OS=Arabidopsis thaliana GN=RHM2 PE=1 SV=1 100 446 1.0E-102
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O95455|TGDS_HUMAN dTDP-D-glucose 4,6-dehydratase OS=Homo sapiens GN=TGDS PE=1 SV=1 100 437 1.0E-105
sp|A6QLW2|TGDS_BOVIN dTDP-D-glucose 4,6-dehydratase OS=Bos taurus GN=TGDS PE=2 SV=1 95 437 3.0E-105
sp|Q9LH76|RHM3_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM3 OS=Arabidopsis thaliana GN=RHM3 PE=1 SV=1 100 436 2.0E-104
sp|Q8VDR7|TGDS_MOUSE dTDP-D-glucose 4,6-dehydratase OS=Mus musculus GN=Tgds PE=2 SV=2 100 437 2.0E-103
sp|Q9LPG6|RHM2_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2 OS=Arabidopsis thaliana GN=RHM2 PE=1 SV=1 100 446 1.0E-102
sp|Q9SYM5|RHM1_ARATH Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 OS=Arabidopsis thaliana GN=RHM1 PE=1 SV=1 100 436 2.0E-101
sp|Q54WS6|TGDS_DICDI dTDP-D-glucose 4,6-dehydratase OS=Dictyostelium discoideum GN=tgds PE=3 SV=1 99 424 1.0E-90
sp|Q5UR12|TGDS_MIMIV Putative dTDP-D-glucose 4,6-dehydratase OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R141 PE=3 SV=1 99 418 7.0E-80
sp|D4GU72|AGL12_HALVD Low-salt glycan biosynthesis protein Agl12 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=agl12 PE=3 SV=1 101 417 1.0E-74
sp|P39630|RMLB_BACSU dTDP-glucose 4,6-dehydratase OS=Bacillus subtilis (strain 168) GN=rfbB PE=1 SV=1 100 417 4.0E-70
sp|P37761|RMLB_NEIGO dTDP-glucose 4,6-dehydratase OS=Neisseria gonorrhoeae GN=rfbB PE=3 SV=1 100 417 3.0E-68
sp|P26391|RMLB_SALTY dTDP-glucose 4,6-dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rfbB PE=1 SV=1 102 417 8.0E-68
sp|P37777|RMLB_SHIFL dTDP-glucose 4,6-dehydratase OS=Shigella flexneri GN=rfbB PE=3 SV=2 102 417 3.0E-65
sp|Q9S642|RMLB_NEIMA dTDP-glucose 4,6-dehydratase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rfbB1 PE=3 SV=1 99 417 3.0E-65
sp|P55294|RMLB_NEIMB dTDP-glucose 4,6-dehydratase OS=Neisseria meningitidis serogroup B (strain MC58) GN=rfbB1 PE=3 SV=2 99 428 4.0E-65
sp|P55462|RFBB_RHISN Probable dTDP-glucose 4,6-dehydratase OS=Rhizobium sp. (strain NGR234) GN=NGR_a03580 PE=3 SV=1 102 425 4.0E-65
sp|P44914|RMLB_HAEIN dTDP-glucose 4,6-dehydratase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rffG PE=3 SV=1 99 417 2.0E-64
sp|P55293|RMLB1_ECOLX dTDP-glucose 4,6-dehydratase OS=Escherichia coli GN=rfbB PE=3 SV=1 102 417 1.0E-63
sp|P37759|RMLB1_ECOLI dTDP-glucose 4,6-dehydratase 1 OS=Escherichia coli (strain K12) GN=rfbB PE=3 SV=2 102 417 3.0E-63
sp|P27830|RMLB2_ECOLI dTDP-glucose 4,6-dehydratase 2 OS=Escherichia coli (strain K12) GN=rffG PE=1 SV=3 99 428 3.0E-62
sp|B0RVL0|RMLB_XANCB dTDP-glucose 4,6-dehydratase OS=Xanthomonas campestris pv. campestris (strain B100) GN=rfbB PE=3 SV=1 103 417 1.0E-61
sp|Q9ZAE8|RMLB_ACTS5 dTDP-glucose 4,6-dehydratase OS=Actinoplanes sp. (strain ATCC 31044 / CBS 674.73 / SE50/110) GN=acbB PE=3 SV=2 101 425 3.0E-60
sp|P0C7J0|RMLB_XANCP dTDP-glucose 4,6-dehydratase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rfbB PE=3 SV=1 103 417 6.0E-60
sp|Q9L9E8|NOVT_STRNV dTDP-glucose 4,6-dehydratase OS=Streptomyces niveus GN=novT PE=3 SV=1 102 425 1.0E-59
sp|Q9HDU4|YHEB_SCHPO Uncharacterized protein PB2B2.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB2B2.11 PE=3 SV=1 103 417 4.0E-58
sp|P29782|RMLB_STRGR dTDP-glucose 4,6-dehydratase OS=Streptomyces griseus GN=strE PE=1 SV=1 101 425 5.0E-58
sp|Q6E7F4|RMLB2_ECOLX dTDP-glucose 4,6-dehydratase OS=Escherichia coli GN=rmlB PE=1 SV=1 102 425 3.0E-55
sp|A0QSK6|RMLB_MYCS2 dTDP-glucose 4,6-dehydratase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rmlB PE=1 SV=1 102 425 2.0E-53
sp|P95780|RMLB_STRMU dTDP-glucose 4,6-dehydratase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rmlB PE=1 SV=2 98 425 3.0E-49
sp|P9WN65|RMLB_MYCTU dTDP-glucose 4,6-dehydratase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=rmlB PE=1 SV=1 102 425 5.0E-48
sp|P9WN64|RMLB_MYCTO dTDP-glucose 4,6-dehydratase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rmlB PE=3 SV=1 102 425 5.0E-48
sp|O34886|YTCB_BACSU Uncharacterized UDP-glucose epimerase YtcB OS=Bacillus subtilis (strain 168) GN=ytcB PE=3 SV=1 101 362 1.0E-27
sp|O06485|YFNG_BACSU Putative sugar dehydratase/epimerase YfnG OS=Bacillus subtilis (strain 168) GN=yfnG PE=3 SV=2 100 420 6.0E-27
sp|A0R5C5|GALE_MYCS2 UDP-glucose 4-epimerase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6142 PE=1 SV=2 103 418 1.0E-24
sp|Q57664|GALE_METJA Putative UDP-glucose 4-epimerase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0211 PE=3 SV=1 102 418 6.0E-24
sp|P9WN67|GALE_MYCTU UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=galE1 PE=1 SV=1 103 418 3.0E-23
sp|P9WN66|GALE_MYCTO UDP-glucose 4-epimerase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=galE1 PE=3 SV=1 103 418 3.0E-23
sp|P35675|YGAE_ERWAM Uncharacterized protein in galE 3'region (Fragment) OS=Erwinia amylovora PE=3 SV=1 102 256 1.0E-22
sp|Q7BJX9|GNE_PLESH UDP-N-acetylglucosamine 4-epimerase OS=Plesiomonas shigelloides GN=wbgU PE=1 SV=1 103 420 1.0E-22
sp|Q04973|VIPB_SALTI Vi polysaccharide biosynthesis protein VipB/TviC OS=Salmonella typhi GN=vipB PE=3 SV=1 103 417 4.0E-22
sp|Q58455|Y1055_METJA Uncharacterized protein MJ1055 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1055 PE=3 SV=1 100 417 3.0E-21
sp|Q8S8T4|UXS4_ARATH UDP-glucuronic acid decarboxylase 4 OS=Arabidopsis thaliana GN=UXS4 PE=2 SV=1 99 422 8.0E-21
sp|P39858|CAPI_STAAU Protein CapI OS=Staphylococcus aureus GN=capI PE=3 SV=1 102 420 2.0E-20
sp|P14169|RFBE_SALTI CDP-paratose 2-epimerase OS=Salmonella typhi GN=rfbE PE=1 SV=2 102 345 4.0E-20
sp|Q9LZI2|UXS2_ARATH UDP-glucuronic acid decarboxylase 2 OS=Arabidopsis thaliana GN=UXS2 PE=1 SV=1 102 422 3.0E-19
sp|P35673|GALE_ERWAM UDP-glucose 4-epimerase OS=Erwinia amylovora GN=galE PE=3 SV=1 101 416 5.0E-19
sp|P55180|GALE_BACSU UDP-glucose 4-epimerase OS=Bacillus subtilis (strain 168) GN=galE PE=3 SV=1 102 408 9.0E-19
sp|Q9SUN3|ARAE3_ARATH Probable UDP-arabinose 4-epimerase 3 OS=Arabidopsis thaliana GN=At4g20460 PE=2 SV=3 76 418 1.0E-18
sp|Q9KDV3|GALE_BACHD UDP-glucose 4-epimerase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=galE PE=3 SV=1 102 326 3.0E-18
sp|O54067|LPSL_RHIME UDP-glucuronate 5'-epimerase OS=Rhizobium meliloti (strain 1021) GN=lspL PE=3 SV=2 103 417 4.0E-18
sp|Q9ZV36|UXS6_ARATH UDP-glucuronic acid decarboxylase 6 OS=Arabidopsis thaliana GN=UXS6 PE=2 SV=1 102 418 4.0E-18
sp|Q6ZDJ7|UGE2_ORYSJ UDP-glucose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UGE-2 PE=2 SV=1 99 419 5.0E-18
sp|Q59678|GALE_MANHA UDP-glucose 4-epimerase OS=Mannheimia haemolytica GN=galE PE=3 SV=1 102 418 7.0E-18
sp|Q05026|GALE_NEIGO UDP-glucose 4-epimerase OS=Neisseria gonorrhoeae GN=galE PE=3 SV=1 101 419 2.0E-17
sp|Q8LDN8|UGE3_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 3 OS=Arabidopsis thaliana GN=UGE3 PE=1 SV=1 100 419 2.0E-17
sp|Q8VZC0|UXS1_ARATH UDP-glucuronic acid decarboxylase 1 OS=Arabidopsis thaliana GN=UXS1 PE=1 SV=1 102 420 2.0E-17
sp|Q331Q7|GERKI_STRSQ dTDP-4-oxo-6-deoxy-D-allose reductase OS=Streptomyces sp. GN=gerKI PE=1 SV=1 100 418 2.0E-17
sp|Q04871|YCL2_ECO11 Uncharacterized 37.6 kDa protein in cld 5'region OS=Escherichia coli O111:H- PE=3 SV=1 103 420 3.0E-17
sp|Q9W0P5|GALE_DROME UDP-glucose 4-epimerase OS=Drosophila melanogaster GN=Gale PE=1 SV=1 102 416 3.0E-17
sp|Q9FIE8|UXS3_ARATH UDP-glucuronic acid decarboxylase 3 OS=Arabidopsis thaliana GN=UXS3 PE=1 SV=1 96 418 3.0E-17
sp|Q9SN95|UXS5_ARATH UDP-glucuronic acid decarboxylase 5 OS=Arabidopsis thaliana GN=UXS5 PE=2 SV=1 102 421 4.0E-17
sp|Q6T1X6|RMD_ANETH GDP-6-deoxy-D-mannose reductase OS=Aneurinibacillus thermoaerophilus GN=rmd PE=1 SV=1 103 419 4.0E-17
sp|P22715|GALE_SALTY UDP-glucose 4-epimerase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=galE PE=3 SV=2 102 419 5.0E-17
sp|Q56093|GALE_SALTI UDP-glucose 4-epimerase OS=Salmonella typhi GN=galE PE=3 SV=2 102 419 5.0E-17
sp|P09147|GALE_ECOLI UDP-glucose 4-epimerase OS=Escherichia coli (strain K12) GN=galE PE=1 SV=1 102 419 5.0E-17
sp|Q9C7W7|UGE4_ARATH UDP-glucose 4-epimerase 4 OS=Arabidopsis thaliana GN=UGE4 PE=1 SV=1 99 416 6.0E-17
sp|Q5PQX0|UXS1_RAT UDP-glucuronic acid decarboxylase 1 OS=Rattus norvegicus GN=Uxs1 PE=1 SV=1 91 419 7.0E-17
sp|Q9HTB6|RMD_PSEAE GDP-6-deoxy-D-mannose reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rmd PE=1 SV=1 151 422 7.0E-17
sp|Q91XL3|UXS1_MOUSE UDP-glucuronic acid decarboxylase 1 OS=Mus musculus GN=Uxs1 PE=1 SV=1 91 419 1.0E-16
sp|Q9F7D4|GALE_YERPE UDP-glucose 4-epimerase OS=Yersinia pestis GN=galE PE=3 SV=1 102 419 1.0E-16
sp|Q5R885|UXS1_PONAB UDP-glucuronic acid decarboxylase 1 OS=Pongo abelii GN=UXS1 PE=2 SV=1 91 419 1.0E-16
sp|O84903|GALE_LACCA UDP-glucose 4-epimerase OS=Lactobacillus casei GN=galE PE=3 SV=1 101 353 1.0E-16
sp|Q42605|UGE1_ARATH Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Arabidopsis thaliana GN=UGE1 PE=1 SV=2 100 416 1.0E-16
sp|O65780|GALE1_CYATE UDP-glucose 4-epimerase GEPI42 OS=Cyamopsis tetragonoloba PE=2 SV=1 101 416 1.0E-16
sp|Q8NBZ7|UXS1_HUMAN UDP-glucuronic acid decarboxylase 1 OS=Homo sapiens GN=UXS1 PE=1 SV=1 91 419 1.0E-16
sp|B0M3E8|UGE1_PEA Bifunctional UDP-glucose 4-epimerase and UDP-xylose 4-epimerase 1 OS=Pisum sativum GN=UGE1 PE=1 SV=2 100 418 2.0E-16
sp|Q5SFA6|CHMD_STRBI dTDP-4-oxo-6-deoxy-D-allose reductase OS=Streptomyces bikiniensis GN=chmD PE=1 SV=1 100 418 2.0E-16
sp|Q9SN58|UGE5_ARATH UDP-glucose 4-epimerase 5 OS=Arabidopsis thaliana GN=UGE5 PE=1 SV=3 100 416 3.0E-16
sp|P04397|GAL10_YEAST Bifunctional protein GAL10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL10 PE=1 SV=2 90 383 3.0E-16
sp|Q9SA77|ARAE1_ARATH UDP-arabinose 4-epimerase 1 OS=Arabidopsis thaliana GN=MUR4 PE=1 SV=1 76 418 5.0E-16
sp|Q8H930|ARAE1_ORYSJ Probable UDP-arabinose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UEL-1 PE=2 SV=2 97 419 6.0E-16
sp|Q43070|GALE1_PEA UDP-glucose 4-epimerase OS=Pisum sativum GN=GALE PE=2 SV=1 100 418 1.0E-15
sp|Q2SYH7|WBIB_BURTA dTDP-L-rhamnose 4-epimerase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=wbiB PE=1 SV=1 98 416 1.0E-15
sp|O65781|GALE2_CYATE UDP-glucose 4-epimerase GEPI48 OS=Cyamopsis tetragonoloba PE=2 SV=1 100 419 2.0E-15
sp|Q8H0B2|ARAE3_ORYSJ Probable UDP-arabinose 4-epimerase 3 OS=Oryza sativa subsp. japonica GN=UEL-3 PE=2 SV=1 76 418 2.0E-15
sp|P24325|GALE_HAEIN UDP-glucose 4-epimerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=galE PE=3 SV=2 102 418 3.0E-15
sp|Q57301|GALE_YEREN UDP-glucose 4-epimerase OS=Yersinia enterocolitica GN=galE PE=3 SV=1 101 344 5.0E-15
sp|P13226|GALE_STRLI UDP-glucose 4-epimerase OS=Streptomyces lividans GN=galE PE=3 SV=2 103 353 6.0E-15
sp|O49213|FCL1_ARATH GDP-L-fucose synthase 1 OS=Arabidopsis thaliana GN=GER1 PE=1 SV=3 240 419 7.0E-15
sp|Q6GMI9|UXS1_DANRE UDP-glucuronic acid decarboxylase 1 OS=Danio rerio GN=uxs1 PE=2 SV=2 76 419 8.0E-15
sp|Q9T0A7|UGE2_ARATH UDP-glucose 4-epimerase 2 OS=Arabidopsis thaliana GN=UGE2 PE=1 SV=1 100 416 9.0E-15
sp|Q6DF08|UXS1_XENTR UDP-glucuronic acid decarboxylase 1 OS=Xenopus tropicalis GN=uxs1 PE=2 SV=1 91 419 2.0E-14
sp|Q9FI17|ARAE4_ARATH Putative UDP-arabinose 4-epimerase 4 OS=Arabidopsis thaliana GN=At5g44480 PE=3 SV=1 99 418 2.0E-14
sp|Q6K2E1|UGE4_ORYSJ UDP-glucose 4-epimerase 4 OS=Oryza sativa subsp. japonica GN=UGE-4 PE=2 SV=1 100 419 2.0E-14
sp|Q553X7|GALE_DICDI UDP-glucose 4-epimerase OS=Dictyostelium discoideum GN=galE PE=1 SV=1 93 416 2.0E-14
sp|O64749|ARAE2_ARATH Putative UDP-arabinose 4-epimerase 2 OS=Arabidopsis thaliana GN=At2g34850 PE=2 SV=3 97 418 4.0E-14
sp|Q9CNY5|GALE_PASMU UDP-glucose 4-epimerase OS=Pasteurella multocida (strain Pm70) GN=galE PE=3 SV=1 102 419 4.0E-14
sp|Q67WR2|FCL1_ORYSJ Probable GDP-L-fucose synthase 1 OS=Oryza sativa subsp. japonica GN=Os06g0652400 PE=2 SV=1 245 417 5.0E-14
sp|Q8H0B6|ARAE2_ORYSJ Probable UDP-arabinose 4-epimerase 2 OS=Oryza sativa subsp. japonica GN=UEL-2 PE=2 SV=1 80 418 9.0E-14
sp|Q59745|EXOB_RHILT UDP-glucose 4-epimerase OS=Rhizobium leguminosarum bv. trifolii GN=exoB PE=3 SV=1 101 419 1.0E-13
sp|Q9LPC1|GAE2_ARATH UDP-glucuronate 4-epimerase 2 OS=Arabidopsis thaliana GN=GAE2 PE=2 SV=1 87 417 1.0E-13
sp|P33119|GALE_CORDI UDP-glucose 4-epimerase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=galE PE=3 SV=2 101 346 2.0E-13
sp|Q8LNZ3|UGE1_ORYSJ UDP-glucose 4-epimerase 1 OS=Oryza sativa subsp. japonica GN=UGE-1 PE=2 SV=1 99 419 2.0E-13
sp|Q7WTB1|GALE_LACHE UDP-glucose 4-epimerase OS=Lactobacillus helveticus GN=galE PE=2 SV=1 102 418 2.0E-13
sp|P21977|GALE_STRTR UDP-glucose 4-epimerase OS=Streptococcus thermophilus GN=galE PE=3 SV=1 102 370 2.0E-13
sp|Q652A8|UGE3_ORYSJ UDP-glucose 4-epimerase 3 OS=Oryza sativa subsp. japonica GN=UGE-3 PE=2 SV=1 101 419 2.0E-13
sp|P56985|GALE_NEIMB UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup B (strain MC58) GN=galE PE=3 SV=1 99 353 3.0E-13
sp|E8MF10|GALE_BIFL2 UDP-glucose 4-epimerase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) GN=lnpD PE=1 SV=1 99 419 4.0E-13
sp|Q9HDU3|GAL10_SCHPO Bifunctional protein gal10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gal10 PE=3 SV=1 102 324 5.0E-13
sp|Q9LMU0|FCL2_ARATH Putative GDP-L-fucose synthase 2 OS=Arabidopsis thaliana GN=GER2 PE=1 SV=1 240 417 9.0E-13
sp|Q59083|EXOB_AZOBR UDP-glucose 4-epimerase OS=Azospirillum brasilense GN=exoB PE=3 SV=1 102 404 1.0E-12
sp|P26397|RFBG_SALTY CDP-glucose 4,6-dehydratase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rfbG PE=1 SV=1 100 418 2.0E-12
sp|O22141|GAE4_ARATH UDP-glucuronate 4-epimerase 4 OS=Arabidopsis thaliana GN=GAE4 PE=1 SV=1 101 417 2.0E-12
sp|P09609|GAL10_KLULA Bifunctional protein GAL10 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GAL10 PE=2 SV=2 103 372 2.0E-12
sp|Q6E7F2|FCF1_ECOLX dTDP-4-dehydro-6-deoxyglucose reductase OS=Escherichia coli GN=fcf1 PE=1 SV=1 102 418 3.0E-12
sp|P56986|GALE_NEIMC UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup C GN=galE PE=3 SV=1 99 353 4.0E-12
sp|P55353|FCL_RHISN GDP-L-fucose synthase OS=Rhizobium sp. (strain NGR234) GN=fcl PE=3 SV=1 98 410 5.0E-12
sp|P56997|GALE_NEIMA UDP-glucose 4-epimerase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=galE PE=3 SV=1 99 353 6.0E-12
sp|P96995|GALE_STRMU UDP-glucose 4-epimerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=galE PE=3 SV=2 102 370 9.0E-12
sp|Q45291|GALE_CORGL UDP-glucose 4-epimerase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=galE PE=3 SV=2 101 346 1.0E-11
sp|Q67WR5|FCL2_ORYSJ Putative GDP-L-fucose synthase 2 OS=Oryza sativa subsp. japonica GN=Os06g0652300 PE=3 SV=1 251 420 2.0E-11
sp|P39853|CAPD_STAAU Capsular polysaccharide biosynthesis protein CapD OS=Staphylococcus aureus GN=capD PE=3 SV=1 100 364 3.0E-11
sp|O81312|GAE3_ARATH UDP-glucuronate 4-epimerase 3 OS=Arabidopsis thaliana GN=GAE3 PE=2 SV=1 87 417 3.0E-11
sp|Q9Y7X5|UGE1_SCHPO UDP-glucose 4-epimerase uge1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uge1 PE=1 SV=1 101 326 4.0E-11
sp|Q9LIS3|GAE6_ARATH UDP-glucuronate 4-epimerase 6 OS=Arabidopsis thaliana GN=GAE6 PE=1 SV=1 96 417 5.0E-11
sp|P47364|GALE_MYCGE UDP-glucose 4-epimerase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=galE PE=3 SV=1 142 353 1.0E-10
sp|Q2R1V8|GME2_ORYSJ GDP-mannose 3,5-epimerase 2 OS=Oryza sativa subsp. japonica GN=GME-2 PE=2 SV=2 102 418 1.0E-10
sp|Q93VR3|GME_ARATH GDP-mannose 3,5-epimerase OS=Arabidopsis thaliana GN=At5g28840 PE=1 SV=1 102 418 2.0E-10
sp|P32055|FCL_ECOLI GDP-L-fucose synthase OS=Escherichia coli (strain K12) GN=fcl PE=1 SV=2 159 417 2.0E-10
sp|Q9M0B6|GAE1_ARATH UDP-glucuronate 4-epimerase 1 OS=Arabidopsis thaliana GN=GAE1 PE=1 SV=1 101 417 2.0E-10
sp|A3C4S4|GME1_ORYSJ GDP-mannose 3,5-epimerase 1 OS=Oryza sativa subsp. japonica GN=GME-1 PE=1 SV=1 95 418 3.0E-10
sp|O45583|GMD2_CAEEL GDP-mannose 4,6 dehydratase 2 OS=Caenorhabditis elegans GN=gmd-2 PE=1 SV=1 148 414 3.0E-10
sp|A2Z7B3|GME1_ORYSI GDP-mannose 3,5-epimerase 1 OS=Oryza sativa subsp. indica GN=OsI_032456 PE=2 SV=1 95 418 3.0E-10
sp|P26503|EXOB_RHIME UDP-glucose 4-epimerase OS=Rhizobium meliloti (strain 1021) GN=exoB PE=3 SV=1 101 419 9.0E-10
sp|Q56598|GM4D_VIBCL GDP-mannose 4,6-dehydratase OS=Vibrio cholerae GN=gmd PE=3 SV=2 100 290 1.0E-09
sp|Q9JRN7|TLD_AGGAC GDP-6-deoxy-D-talose 4-dehydrogenase OS=Aggregatibacter actinomycetemcomitans GN=tld PE=1 SV=1 102 344 1.0E-09
sp|Q3T105|GALE_BOVIN UDP-glucose 4-epimerase OS=Bos taurus GN=GALE PE=2 SV=2 101 418 3.0E-09
sp|Q14376|GALE_HUMAN UDP-glucose 4-epimerase OS=Homo sapiens GN=GALE PE=1 SV=2 101 418 5.0E-09
sp|P18645|GALE_RAT UDP-glucose 4-epimerase OS=Rattus norvegicus GN=Gale PE=2 SV=1 101 418 5.0E-09
sp|P75821|YBJS_ECOLI Uncharacterized protein YbjS OS=Escherichia coli (strain K12) GN=ybjS PE=3 SV=2 147 423 8.0E-09
sp|P40801|GAL10_PACTA Bifunctional protein GAL10 OS=Pachysolen tannophilus GN=GAL10 PE=2 SV=1 102 362 1.0E-08
sp|A8Y0L5|GMD1_CAEBR GDP-mannose 4,6 dehydratase 1 OS=Caenorhabditis briggsae GN=bre-1 PE=3 SV=2 103 332 1.0E-08
sp|Q18801|GMD1_CAEEL GDP-mannose 4,6 dehydratase 1 OS=Caenorhabditis elegans GN=bre-1 PE=1 SV=3 152 414 3.0E-08
sp|Q58461|Y1061_METJA Uncharacterized membrane protein MJ1061 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1061 PE=3 SV=1 100 340 3.0E-08
sp|Q5R8D0|GALE_PONAB UDP-glucose 4-epimerase OS=Pongo abelii GN=GALE PE=2 SV=1 101 418 3.0E-08
sp|Q06952|GM4D_VIBCH GDP-mannose 4,6-dehydratase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gmd PE=3 SV=1 139 290 3.0E-08
sp|O60547|GMDS_HUMAN GDP-mannose 4,6 dehydratase OS=Homo sapiens GN=GMDS PE=1 SV=1 152 414 3.0E-08
sp|P45602|GALE_KLEPN UDP-glucose 4-epimerase (Fragment) OS=Klebsiella pneumoniae GN=galE PE=3 SV=1 101 231 4.0E-08
sp|P55354|GM4D_RHISN GDP-mannose 4,6-dehydratase OS=Rhizobium sp. (strain NGR234) GN=gmd PE=3 SV=1 153 288 4.0E-08
sp|Q56623|GALE_VIBCL UDP-glucose 4-epimerase OS=Vibrio cholerae GN=galE PE=3 SV=1 100 419 4.0E-08
sp|O85713|GM4D_RHIFH GDP-mannose 4,6-dehydratase OS=Rhizobium fredii (strain HH103) GN=gmd PE=3 SV=1 153 288 5.0E-08
sp|A1VGB0|HLDD_DESVV ADP-L-glycero-D-manno-heptose-6-epimerase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=hldD PE=3 SV=1 103 372 6.0E-08
sp|Q8R059|GALE_MOUSE UDP-glucose 4-epimerase OS=Mus musculus GN=Gale PE=1 SV=1 99 418 1.0E-07
sp|P71052|EPSC_BACSU Probable polysaccharide biosynthesis protein EpsC OS=Bacillus subtilis (strain 168) GN=epsC PE=3 SV=1 83 382 1.0E-07
sp|Q9SNY3|GMD1_ARATH GDP-mannose 4,6 dehydratase 1 OS=Arabidopsis thaliana GN=GMD1 PE=1 SV=1 139 415 1.0E-07
sp|Q9STI6|GAE5_ARATH UDP-glucuronate 4-epimerase 5 OS=Arabidopsis thaliana GN=GAE5 PE=2 SV=1 101 420 2.0E-07
sp|Q1ZXF7|GMDS_DICDI GDP-mannose 4,6 dehydratase OS=Dictyostelium discoideum GN=gmd PE=1 SV=1 147 333 2.0E-07
sp|Q56872|GM4D_YERE8 GDP-mannose 4,6-dehydratase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gmd PE=3 SV=2 152 290 3.0E-07
sp|P53199|ERG26_YEAST Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG26 PE=1 SV=1 99 326 4.0E-07
sp|P0A5D2|Y513_MYCBO Uncharacterized protein Mb0513 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb0513 PE=3 SV=1 102 344 4.0E-07
sp|P9WKT3|Y501_MYCTU Uncharacterized protein Rv0501 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0501 PE=1 SV=1 102 344 4.0E-07
sp|P9WKT2|Y501_MYCTO Uncharacterized protein MT0522 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0522 PE=3 SV=1 102 344 4.0E-07
sp|Q9VMW9|GMDS_DROME GDP-mannose 4,6 dehydratase OS=Drosophila melanogaster GN=Gmd PE=1 SV=2 155 333 1.0E-06
sp|Q0P9D4|PGLF_CAMJE UDP-N-acetyl-alpha-D-glucosamine C6 dehydratase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pglF PE=1 SV=1 100 358 1.0E-06
sp|P0AC91|GM4D_SHIFL GDP-mannose 4,6-dehydratase OS=Shigella flexneri GN=gmd PE=3 SV=1 152 290 4.0E-06
sp|P0AC88|GM4D_ECOLI GDP-mannose 4,6-dehydratase OS=Escherichia coli (strain K12) GN=gmd PE=1 SV=1 152 290 4.0E-06
sp|P0AC89|GM4D_ECOL6 GDP-mannose 4,6-dehydratase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gmd PE=3 SV=1 152 290 4.0E-06
sp|P0AC90|GM4D_ECO57 GDP-mannose 4,6-dehydratase OS=Escherichia coli O157:H7 GN=gmd PE=3 SV=1 152 290 4.0E-06
sp|A9MKQ6|HLDD_SALAR ADP-L-glycero-D-manno-heptose-6-epimerase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=hldD PE=3 SV=1 102 344 4.0E-06
sp|Q4QLI0|HLDD_HAEI8 ADP-L-glycero-D-manno-heptose-6-epimerase OS=Haemophilus influenzae (strain 86-028NP) GN=hldD PE=3 SV=1 102 419 6.0E-06
sp|A5UIN9|HLDD_HAEIG ADP-L-glycero-D-manno-heptose-6-epimerase OS=Haemophilus influenzae (strain PittGG) GN=hldD PE=3 SV=1 102 419 7.0E-06
sp|P45048|HLDD_HAEIN ADP-L-glycero-D-manno-heptose-6-epimerase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hldD PE=3 SV=1 102 419 9.0E-06
sp|P37760|RMLD_ECOLI dTDP-4-dehydrorhamnose reductase OS=Escherichia coli (strain K12) GN=rfbD PE=3 SV=2 101 345 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003854 3-beta-hydroxy-delta5-steroid dehydrogenase activity Yes
GO:0006694 steroid biosynthetic process Yes
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0009058 biosynthetic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0006629 lipid metabolic process No
GO:0008152 metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0016491 oxidoreductase activity No
GO:0016229 steroid dehydrogenase activity No
GO:0033764 steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0008202 steroid metabolic process No
GO:0008610 lipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5504
MAPGRPCLSPVWPDRRPYPSGDNDGEGEGNVGGDGDGSGNGHGHGQGYRNGYRNGQGYGNGYGHGHGHSHHCRYP
LDLNVWKRAPVLRGTTRFEPRPDVRNIMVTGGAGFIASWVVRHLALTYPQAYNVVSFDKLDYCSSLNNTRALNDK
RNFTFYHGDLTNPSEVLDCMERYDIDTVLHFAAQSHVDLSFGNSYSFTHANVYGTHVLLESAKKVRVKCFIHVST
DEVYGEVKHDDGELLETSILAPSNPYAASKAAAEMLVQSYQKSFKLPAMIVRSNNVYGPHQYPEKIIPKFACLVN
RQRPVVLHGDGSPTRRYLYASDAADAFDTILHKGEVGQIYNVGSSDEISNLELSGRVLDAMGIEPDHAERMRSWI
RWTRDRPFNDRRYAVDGTKLRELGWRQKMGLDEGLRVTVDWYRRFGELWWGDISHVLTPFPIVGEAGMLSDDEYA
VGGEAPPEPVEDDGRQKAW*
Coding >Hirsu2|5504
ATGGCACCCGGTAGGCCCTGTCTTTCGCCTGTCTGGCCCGACCGCAGACCCTATCCGTCTGGCGACAACGACGGG
GAGGGCGAAGGAAACGTCGGCGGCGACGGCGATGGCAGTGGCAACGGCCACGGCCACGGCCAAGGCTACCGCAAC
GGCTACCGCAACGGCCAAGGCTACGGCAATGGCTACGGCCACGGCCACGGCCACAGCCATCATTGCCGCTATCCC
CTAGACCTCAACGTCTGGAAACGGGCTCCCGTCCTGAGGGGCACCACGCGGTTCGAGCCTAGGCCAGATGTCCGC
AATATCATGGTCACAGGCGGCGCGGGCTTCATCGCCTCCTGGGTGGTCCGCCATCTCGCCCTGACGTACCCCCAG
GCTTACAACGTCGTCTCCTTCGATAAGCTCGACTACTGCTCCTCGCTTAACAACACGCGCGCCCTCAACGATAAG
CGCAACTTCACCTTCTACCACGGCGACCTCACCAACCCATCCGAGGTGCTCGACTGCATGGAGCGCTACGACATC
GATACCGTCCTGCACTTCGCCGCTCAGTCGCATGTGGACCTCAGCTTTGGCAACTCGTACAGCTTCACCCACGCC
AACGTCTACGGCACCCATGTTCTTCTCGAGAGCGCCAAGAAGGTCCGCGTCAAGTGCTTCATCCACGTCTCCACC
GATGAAGTGTACGGCGAGGTCAAGCACGACGACGGCGAGCTGTTGGAGACGAGCATTCTGGCGCCCTCGAATCCC
TACGCCGCAAGCAAGGCCGCCGCCGAAATGCTGGTCCAGTCGTACCAGAAGAGCTTCAAGCTCCCGGCCATGATT
GTTCGGAGCAATAACGTGTACGGGCCGCACCAGTATCCCGAGAAGATTATACCGAAATTCGCCTGCCTCGTCAAT
AGGCAGCGACCGGTGGTGCTGCATGGCGACGGGAGCCCCACGCGACGTTACTTGTATGCGAGTGACGCGGCAGAC
GCCTTCGACACCATCCTCCACAAGGGCGAGGTCGGGCAAATCTATAACGTGGGGTCCTCGGACGAGATCTCCAAC
CTCGAGCTCAGCGGCCGGGTGCTCGACGCCATGGGGATCGAGCCGGACCACGCGGAGCGCATGCGGAGCTGGATC
CGCTGGACCAGGGACAGGCCCTTTAACGACCGCCGGTACGCCGTGGACGGGACCAAGCTGCGGGAGCTGGGCTGG
CGGCAAAAGATGGGCCTCGACGAGGGCCTGCGCGTGACGGTGGACTGGTATCGACGATTCGGGGAGCTGTGGTGG
GGAGACATCAGCCATGTTCTGACGCCCTTCCCCATCGTTGGCGAGGCGGGCATGTTGTCGGACGACGAATACGCC
GTCGGGGGCGAGGCTCCCCCCGAGCCCGTCGAAGACGACGGCCGGCAGAAGGCATGGTAG
Transcript >Hirsu2|5504
ATGGCACCCGGTAGGCCCTGTCTTTCGCCTGTCTGGCCCGACCGCAGACCCTATCCGTCTGGCGACAACGACGGG
GAGGGCGAAGGAAACGTCGGCGGCGACGGCGATGGCAGTGGCAACGGCCACGGCCACGGCCAAGGCTACCGCAAC
GGCTACCGCAACGGCCAAGGCTACGGCAATGGCTACGGCCACGGCCACGGCCACAGCCATCATTGCCGCTATCCC
CTAGACCTCAACGTCTGGAAACGGGCTCCCGTCCTGAGGGGCACCACGCGGTTCGAGCCTAGGCCAGATGTCCGC
AATATCATGGTCACAGGCGGCGCGGGCTTCATCGCCTCCTGGGTGGTCCGCCATCTCGCCCTGACGTACCCCCAG
GCTTACAACGTCGTCTCCTTCGATAAGCTCGACTACTGCTCCTCGCTTAACAACACGCGCGCCCTCAACGATAAG
CGCAACTTCACCTTCTACCACGGCGACCTCACCAACCCATCCGAGGTGCTCGACTGCATGGAGCGCTACGACATC
GATACCGTCCTGCACTTCGCCGCTCAGTCGCATGTGGACCTCAGCTTTGGCAACTCGTACAGCTTCACCCACGCC
AACGTCTACGGCACCCATGTTCTTCTCGAGAGCGCCAAGAAGGTCCGCGTCAAGTGCTTCATCCACGTCTCCACC
GATGAAGTGTACGGCGAGGTCAAGCACGACGACGGCGAGCTGTTGGAGACGAGCATTCTGGCGCCCTCGAATCCC
TACGCCGCAAGCAAGGCCGCCGCCGAAATGCTGGTCCAGTCGTACCAGAAGAGCTTCAAGCTCCCGGCCATGATT
GTTCGGAGCAATAACGTGTACGGGCCGCACCAGTATCCCGAGAAGATTATACCGAAATTCGCCTGCCTCGTCAAT
AGGCAGCGACCGGTGGTGCTGCATGGCGACGGGAGCCCCACGCGACGTTACTTGTATGCGAGTGACGCGGCAGAC
GCCTTCGACACCATCCTCCACAAGGGCGAGGTCGGGCAAATCTATAACGTGGGGTCCTCGGACGAGATCTCCAAC
CTCGAGCTCAGCGGCCGGGTGCTCGACGCCATGGGGATCGAGCCGGACCACGCGGAGCGCATGCGGAGCTGGATC
CGCTGGACCAGGGACAGGCCCTTTAACGACCGCCGGTACGCCGTGGACGGGACCAAGCTGCGGGAGCTGGGCTGG
CGGCAAAAGATGGGCCTCGACGAGGGCCTGCGCGTGACGGTGGACTGGTATCGACGATTCGGGGAGCTGTGGTGG
GGAGACATCAGCCATGTTCTGACGCCCTTCCCCATCGTTGGCGAGGCGGGCATGTTGTCGGACGACGAATACGCC
GTCGGGGGCGAGGCTCCCCCCGAGCCCGTCGAAGACGACGGCCGGCAGAAGGCATGGTAG
Gene >Hirsu2|5504
ATGGCACCCGGTAGGCCCTGTCTTTCGCCTGTCTGGCCCGACCGCAGACCCTATCCGTCTGGCGACAACGACGGG
GAGGGCGAAGGAAACGTCGGCGGCGACGGCGATGGCAGTGGCAACGGCCACGGCCACGGCCAAGGCTACCGCAAC
GGCTACCGCAACGGCCAAGGCTACGGCAATGGCTACGGCCACGGCCACGGCCACAGCCATCATTGCCGCTATCCC
CTAGACCTCAACGTCTGGAAACGGGCTCCCGTCCTGAGGGGCACCACGCGGTTCGAGCCTAGGCCAGATGTCCGC
AATATCATGGTCACAGGCGGCGCGGGCTTCATGTGAGGCATCTCGCCGCCCACCCGCGACCTCTCCCACCTCGAC
GGCTGACCTGGCACGCAACACAGCGCCTCCTGGGTGGTCCGCCATCTCGCCCTGACGTACCCCCAGGCTTACAAC
GTCGTCTCCTTCGATAAGCTCGACTACTGCTCCTCGCTTAACAACACGCGCGCCCTCAACGATAAGCGCAACTTC
ACCTTCTACCACGGCGACCTCACCAACCCATCCGAGGTGCTCGACTGCATGGAGCGCTACGACATCGATACCGTC
CTGCACTTCGCCGCTCAGTCGCATGTGGACCTCAGCTTTGGCAACTCGTACAGCTTCACCCACGCCAACGTCTAC
GGCACCCATGTTCTTCTCGAGAGCGCCAAGAAGGTCCGCGTCAAGTGCTTCATCCACGTCTCCACCGATGAAGTG
TACGGCGAGGTCAAGCACGACGACGGCGAGCTGTTGGAGACGAGCATTCTGGCGCCCTCGAATCCCTACGCCGCA
AGCAAGGCCGCCGCCGAAATGCTGGTCCAGTCGTACCAGAAGAGCTTCAAGCTCCCGGCCATGATTGTTCGGAGC
AATAACGTGTACGGGCCGCACCAGTATCCCGAGAGTAAGTTGCCGTCCCTCCAACCCCCCTTTGGTCCATGAACG
CCATGGCATGGTGAGGCAGCGTCGTGCTAAAGAAGCCATGACAGAGATTATACCGAAATTCGCCTGCCTCGTCAA
TAGGCAGCGACCGGTGGTGCTGCATGGCGACGGGAGCCCCACGCGACGTTACTTGTATGCGAGTGACGCGGCAGA
CGCCTTCGACACCATCCTCCACAAGGGCGAGGTCGGGCAAATCTATAACGTGGGGTCCTCGGACGAGATCTCCAA
CCTCGAGCTCAGCGGCCGGGTGCTCGACGCCATGGGGATCGAGCCGGACCACGCGGAGCGCATGCGGAGCTGGAT
CCGCTGGACCAGGGACAGGCCCTTTAACGACCGCCGGTACGCCGTGGACGGGACCAAGCTGCGGGAGCTGGGCTG
GCGGCAAAAGATGGGCCTCGACGAGGGCCTGCGCGTGACGGTGGACTGGTATCGACGATTCGGGGAGCTGTGGTG
GGGAGACATCAGCCATGTTCTGACGCCCTTCCCCATCGTTGGCGAGGCGGGCATGTTGTCGGACGACGAATACGC
CGTCGGGGGCGAGGCTCCCCCCGAGCCCGTCGAAGACGACGGCCGGCAGAAGGCATGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail