Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5503
Gene name
LocationContig_2759:47..1887
Strand+
Gene length (bp)1840
Transcript length (bp)1551
Coding sequence length (bp)1551
Protein length (aa) 517

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 3.1E-06 273 332
PF00005 ABC_tran ABC transporter 7.9E-10 200 245

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 197 467 8.0E-43
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 130 450 2.0E-42
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 197 478 2.0E-42
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 161 447 3.0E-42
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 5 453 4.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 197 467 8.0E-43
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 130 450 2.0E-42
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 197 478 2.0E-42
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 161 447 3.0E-42
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 5 453 4.0E-42
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 138 450 5.0E-42
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 186 455 3.0E-41
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 3 453 1.0E-40
sp|Q8T6J1|ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum GN=abcA6 PE=3 SV=1 197 448 3.0E-40
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 162 466 9.0E-40
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 196 470 2.0E-39
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 3 453 3.0E-39
sp|Q54BT5|ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum GN=abcA3 PE=3 SV=1 197 448 6.0E-39
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 180 455 8.0E-39
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 197 462 5.0E-38
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 197 448 3.0E-37
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 197 448 3.0E-37
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 6 467 7.0E-37
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 199 458 7.0E-37
sp|Q84K47|AB2A_ARATH ABC transporter A family member 2 OS=Arabidopsis thaliana GN=ABCA2 PE=2 SV=1 145 452 3.0E-36
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 196 445 4.0E-36
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 198 516 6.0E-36
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 194 467 1.0E-35
sp|Q9FLT5|AB9A_ARATH ABC transporter A family member 9 OS=Arabidopsis thaliana GN=ABCA9 PE=1 SV=1 161 452 1.0E-34
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 195 371 2.0E-34
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 197 379 2.0E-34
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 195 405 4.0E-34
sp|Q9FKF2|AB11A_ARATH ABC transporter A family member 11 OS=Arabidopsis thaliana GN=ABCA11 PE=3 SV=1 161 459 5.0E-34
sp|Q54DT1|ABCA9_DICDI ABC transporter A family member 9 OS=Dictyostelium discoideum GN=abcA9 PE=3 SV=1 167 446 6.0E-34
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 198 375 8.0E-34
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 190 376 9.0E-34
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 196 453 3.0E-33
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 196 453 4.0E-33
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 198 368 7.0E-33
sp|Q8T6J0|ABCA7_DICDI ABC transporter A family member 7 OS=Dictyostelium discoideum GN=abcA7 PE=3 SV=1 171 446 2.0E-32
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 198 454 2.0E-32
sp|Q54R52|ABCAA_DICDI ABC transporter A family member 10 OS=Dictyostelium discoideum GN=abcA10 PE=3 SV=1 148 369 7.0E-31
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 193 463 2.0E-30
sp|Q8T5Z7|ABCA1_DICDI ABC transporter A family member 1 OS=Dictyostelium discoideum GN=abcA1 PE=2 SV=1 191 447 3.0E-30
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 193 463 5.0E-30
sp|Q1PEH6|AB3A_ARATH ABC transporter A family member 3 OS=Arabidopsis thaliana GN=ABCA3 PE=2 SV=3 160 450 5.0E-30
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 198 373 5.0E-30
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 193 463 1.0E-29
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 159 454 2.0E-29
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 165 447 2.0E-29
sp|Q9FLT8|AB12A_ARATH ABC transporter A family member 12 OS=Arabidopsis thaliana GN=ABCA12 PE=3 SV=1 151 369 2.0E-29
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 159 454 3.0E-29
sp|Q9STT6|AB6A_ARATH ABC transporter A family member 6 OS=Arabidopsis thaliana GN=ABCA6 PE=3 SV=2 159 447 3.0E-29
sp|Q8LPK0|AB8A_ARATH ABC transporter A family member 8 OS=Arabidopsis thaliana GN=ABCA8 PE=2 SV=3 159 373 3.0E-29
sp|Q9STT5|AB7A_ARATH ABC transporter A family member 7 OS=Arabidopsis thaliana GN=ABCA7 PE=3 SV=2 160 369 3.0E-29
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 159 454 4.0E-29
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 197 448 4.0E-29
sp|O94911|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3 193 463 9.0E-29
sp|Q55BC0|ABCA8_DICDI ABC transporter A family member 8 OS=Dictyostelium discoideum GN=abcA8 PE=3 SV=1 119 373 1.0E-28
sp|O94911|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3 19 445 2.0E-28
sp|Q9FLT4|AB10A_ARATH ABC transporter A family member 10 OS=Arabidopsis thaliana GN=ABCA10 PE=1 SV=2 152 369 2.0E-28
sp|Q9STT7|AB5A_ARATH ABC transporter A family member 5 OS=Arabidopsis thaliana GN=ABCA5 PE=3 SV=2 197 450 2.0E-28
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 197 448 6.0E-28
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 193 446 7.0E-28
sp|Q9STT8|AB4A_ARATH ABC transporter A family member 4 OS=Arabidopsis thaliana GN=ABCA4 PE=3 SV=2 160 450 1.0E-27
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 154 448 8.0E-27
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 154 454 1.0E-26
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 198 452 1.0E-26
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 190 373 5.0E-26
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 179 448 6.0E-26
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 197 457 6.0E-26
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 197 457 7.0E-26
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 186 457 8.0E-26
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 124 487 1.0E-25
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 108 448 1.0E-25
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 155 373 5.0E-25
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 190 455 1.0E-24
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 190 455 2.0E-24
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 154 458 2.0E-24
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 196 374 7.0E-23
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 190 448 8.0E-23
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 176 448 1.0E-22
sp|Q54BT5|ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum GN=abcA3 PE=3 SV=1 183 373 4.0E-22
sp|Q552P3|ABCAB_DICDI ABC transporter A family member 11 OS=Dictyostelium discoideum GN=abcA11 PE=3 SV=1 198 453 6.0E-22
sp|Q8GNH6|NODI_RHIML Nod factor export ATP-binding protein I OS=Rhizobium meliloti GN=nodI PE=3 SV=1 202 451 2.0E-21
sp|Q1LKJ2|NODI_CUPMC Nod factor export ATP-binding protein I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nodI PE=3 SV=1 197 451 6.0E-21
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 197 373 2.0E-20
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 182 373 3.0E-20
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 197 451 3.0E-20
sp|P32010|DRRA_STRPE Daunorubicin/doxorubicin resistance ATP-binding protein DrrA OS=Streptomyces peucetius GN=drrA PE=1 SV=1 198 403 3.0E-20
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 197 451 7.0E-20
sp|Q8KLG1|NODI_RHIEC Nod factor export ATP-binding protein I OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nodI PE=3 SV=3 199 446 1.0E-19
sp|P23703|NODI_RHILO Nod factor export ATP-binding protein I OS=Rhizobium loti (strain MAFF303099) GN=nodI PE=3 SV=2 197 446 2.0E-19
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 199 367 3.0E-19
sp|O52618|NODI_RHIME Nod factor export ATP-binding protein I OS=Rhizobium meliloti (strain 1021) GN=nodI PE=3 SV=3 202 451 5.0E-19
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 202 451 2.0E-18
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 195 373 3.0E-18
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 202 361 5.0E-18
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 202 446 5.0E-18
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 202 446 5.0E-18
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 202 446 5.0E-18
sp|O07016|YVFR_BACSU Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1 198 447 5.0E-18
sp|Q8T6J1|ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum GN=abcA6 PE=3 SV=1 189 373 6.0E-18
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 197 446 7.0E-18
sp|P72335|NODI_RHIS3 Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain N33) GN=nodI PE=3 SV=1 197 446 1.0E-17
sp|O34977|YTHP_BACSU Uncharacterized ABC transporter ATP-binding protein YthP OS=Bacillus subtilis (strain 168) GN=ythP PE=3 SV=1 189 366 1.0E-17
sp|P37624|RBBA_ECOLI Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3 197 387 4.0E-17
sp|Q9Z3I3|NODI_BRASS Nod factor export ATP-binding protein I OS=Bradyrhizobium sp. (strain SNU001) GN=nodI PE=3 SV=1 197 446 6.0E-17
sp|Q9KP42|THIQ_VIBCH Thiamine import ATP-binding protein ThiQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=thiQ PE=3 SV=2 201 353 7.0E-17
sp|A1B9H9|SSUB1_PARDP Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Paracoccus denitrificans (strain Pd 1222) GN=ssuB1 PE=3 SV=1 184 352 1.0E-16
sp|P55476|NODI_RHISN Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain NGR234) GN=nodI PE=3 SV=1 197 451 2.0E-16
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 198 361 3.0E-16
sp|Q13ZJ1|NODI_BURXL Nod factor export ATP-binding protein I OS=Burkholderia xenovorans (strain LB400) GN=nodI PE=3 SV=1 202 451 3.0E-16
sp|Q4A5A5|ECFA1_MYCS5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1 191 357 5.0E-16
sp|P50332|NODI_RHIGA Nod factor export ATP-binding protein I OS=Rhizobium galegae GN=nodI PE=3 SV=1 199 446 7.0E-16
sp|P55339|ECSA_BACSU ABC-type transporter ATP-binding protein EcsA OS=Bacillus subtilis (strain 168) GN=ecsA PE=1 SV=1 193 366 1.0E-15
sp|Q46YX6|NODI_CUPPJ Nod factor export ATP-binding protein I OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nodI PE=3 SV=1 181 451 2.0E-15
sp|P36879|YADG_ECOLI Uncharacterized ABC transporter ATP-binding protein YadG OS=Escherichia coli (strain K12) GN=yadG PE=3 SV=1 196 352 2.0E-15
sp|Q98QH5|ECFA1_MYCPU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ecfA1 PE=3 SV=1 198 361 3.0E-15
sp|P9WQL9|DRRA_MYCTU Doxorubicin resistance ATP-binding protein DrrA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=drrA PE=1 SV=1 196 448 4.0E-15
sp|P9WQL8|DRRA_MYCTO Doxorubicin resistance ATP-binding protein DrrA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=drrA PE=3 SV=1 196 448 4.0E-15
sp|Q1M7W6|NODI_RHIL3 Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nodI PE=3 SV=2 197 446 5.0E-15
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 198 367 6.0E-15
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 198 367 6.0E-15
sp|Q8RLB6|SSUB_DELAC Aliphatic sulfonates import ATP-binding protein SsuB OS=Delftia acidovorans GN=ssuB PE=3 SV=1 201 352 8.0E-15
sp|P08720|NODI_RHILV Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae GN=nodI PE=3 SV=1 197 446 1.0E-14
sp|Q2YYM4|ECFA1_STAAB Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ecfA1 PE=3 SV=2 198 367 1.0E-14
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 198 361 2.0E-14
sp|P38046|NRTD_SYNE7 Nitrate transport ATP-binding protein NrtD OS=Synechococcus elongatus (strain PCC 7942) GN=nrtD PE=3 SV=1 192 361 2.0E-14
sp|Q5HDY6|ECFA1_STAAC Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain COL) GN=ecfA1 PE=3 SV=1 198 364 2.0E-14
sp|Q2FW34|ECFA1_STAA8 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain NCTC 8325) GN=ecfA1 PE=3 SV=1 198 364 2.0E-14
sp|Q2FER7|ECFA1_STAA3 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain USA300) GN=ecfA1 PE=3 SV=1 198 364 2.0E-14
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 196 357 2.0E-14
sp|Q67SV5|METN_SYMTH Methionine import ATP-binding protein MetN OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metN PE=3 SV=1 190 388 2.0E-14
sp|Q5YZY9|CYSA_NOCFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Nocardia farcinica (strain IFM 10152) GN=cysA PE=3 SV=1 198 364 3.0E-14
sp|Q5E882|THIQ_VIBF1 Thiamine import ATP-binding protein ThiQ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=thiQ PE=3 SV=1 201 361 4.0E-14
sp|C0SPB4|YHAQ_BACSU Uncharacterized ABC transporter ATP-binding protein YhaQ OS=Bacillus subtilis (strain 168) GN=yhaQ PE=3 SV=1 198 444 4.0E-14
sp|Q6GEL3|ECFA1_STAAR Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MRSA252) GN=ecfA1 PE=3 SV=1 198 364 5.0E-14
sp|Q7A470|ECFA1_STAAN Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain N315) GN=ecfA1 PE=3 SV=1 198 364 6.0E-14
sp|Q99S47|ECFA1_STAAM Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ecfA1 PE=3 SV=1 198 364 6.0E-14
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 192 356 7.0E-14
sp|Q8NVB5|ECFA1_STAAW Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MW2) GN=ecfA1 PE=3 SV=1 198 364 7.0E-14
sp|Q6G799|ECFA1_STAAS Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Staphylococcus aureus (strain MSSA476) GN=ecfA1 PE=3 SV=1 198 364 7.0E-14
sp|Q325U1|METN_SHIBS Methionine import ATP-binding protein MetN OS=Shigella boydii serotype 4 (strain Sb227) GN=metN PE=3 SV=1 162 352 7.0E-14
sp|Q8YDR7|Y3108_BRUME Putative ATP-binding protein BMEII0108 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=BMEII0108 PE=3 SV=2 197 348 8.0E-14
sp|Q0TLD2|METN_ECOL5 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metN PE=3 SV=1 162 352 8.0E-14
sp|Q87SV4|THIQ_VIBPA Thiamine import ATP-binding protein ThiQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thiQ PE=3 SV=1 202 357 8.0E-14
sp|P22040|Y415_SYNY3 Uncharacterized ABC transporter ATP-binding protein sll0415 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0415 PE=3 SV=2 149 448 8.0E-14
sp|Q3Z5F8|METN_SHISS Methionine import ATP-binding protein MetN OS=Shigella sonnei (strain Ss046) GN=metN PE=3 SV=1 162 352 8.0E-14
sp|Q1RFY9|METN_ECOUT Methionine import ATP-binding protein MetN OS=Escherichia coli (strain UTI89 / UPEC) GN=metN PE=3 SV=1 162 352 8.0E-14
sp|P63355|METN_ECOL6 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metN PE=3 SV=1 162 352 8.0E-14
sp|P63356|METN_ECO57 Methionine import ATP-binding protein MetN OS=Escherichia coli O157:H7 GN=metN PE=3 SV=1 162 352 8.0E-14
sp|P9WQL6|FLQE1_MYCTO Fluoroquinolones export ATP-binding protein MT2762 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2762 PE=3 SV=1 190 362 8.0E-14
sp|Q32JQ8|METN_SHIDS Methionine import ATP-binding protein MetN OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metN PE=3 SV=1 162 352 9.0E-14
sp|P9WQL7|FLQE1_MYCTU Fluoroquinolones export ATP-binding protein Rv2688c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2688c PE=1 SV=1 190 362 9.0E-14
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 192 362 1.0E-13
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 192 362 1.0E-13
sp|P30750|METN_ECOLI Methionine import ATP-binding protein MetN OS=Escherichia coli (strain K12) GN=metN PE=1 SV=4 162 352 1.0E-13
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 199 355 1.0E-13
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 162 357 1.0E-13
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 199 355 2.0E-13
sp|Q1M7A6|SSUB2_RHIL3 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ssuB2 PE=3 SV=1 172 352 2.0E-13
sp|Q7MPC5|THIQ_VIBVY Thiamine import ATP-binding protein ThiQ OS=Vibrio vulnificus (strain YJ016) GN=thiQ PE=3 SV=1 202 364 2.0E-13
sp|Q8DE95|THIQ_VIBVU Thiamine import ATP-binding protein ThiQ OS=Vibrio vulnificus (strain CMCP6) GN=thiQ PE=3 SV=1 202 364 2.0E-13
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 199 357 2.0E-13
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 198 364 2.0E-13
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 192 357 2.0E-13
sp|O26236|Y133_METTH Putative ABC transporter ATP-binding protein MTH_133 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_133 PE=3 SV=1 198 361 3.0E-13
sp|Q39AT4|METN2_BURL3 Methionine import ATP-binding protein MetN 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN2 PE=3 SV=1 192 356 3.0E-13
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 196 356 3.0E-13
sp|A0B344|METN2_BURCH Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain HI2424) GN=metN2 PE=3 SV=1 192 356 4.0E-13
sp|Q1BR30|METN2_BURCA Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN2 PE=3 SV=1 192 356 4.0E-13
sp|P94374|YXLF_BACSU Uncharacterized ABC transporter ATP-binding protein YxlF OS=Bacillus subtilis (strain 168) GN=yxlF PE=2 SV=1 198 445 4.0E-13
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 199 355 4.0E-13
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 199 355 5.0E-13
sp|Q62B84|METN2_BURMA Methionine import ATP-binding protein MetN 2 OS=Burkholderia mallei (strain ATCC 23344) GN=metN2 PE=3 SV=2 192 356 5.0E-13
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 199 355 5.0E-13
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 199 355 5.0E-13
sp|Q3JHC9|METN2_BURP1 Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain 1710b) GN=metN2 PE=3 SV=2 192 356 5.0E-13
sp|Q63NI4|METN2_BURPS Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain K96243) GN=metN2 PE=3 SV=2 192 356 6.0E-13
sp|Q9Z3R9|AGLK_RHIME Alpha-glucoside transport ATP-binding protein AglK OS=Rhizobium meliloti (strain 1021) GN=aglK PE=3 SV=2 202 364 6.0E-13
sp|Q9CK97|METN_PASMU Methionine import ATP-binding protein MetN OS=Pasteurella multocida (strain Pm70) GN=metN PE=3 SV=1 194 361 6.0E-13
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 194 361 6.0E-13
sp|Q83MC5|METN_SHIFL Methionine import ATP-binding protein MetN OS=Shigella flexneri GN=metN PE=3 SV=1 162 352 6.0E-13
sp|Q0T810|METN_SHIF8 Methionine import ATP-binding protein MetN OS=Shigella flexneri serotype 5b (strain 8401) GN=metN PE=3 SV=1 162 352 6.0E-13
sp|Q0S6U9|SSUB2_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Rhodococcus jostii (strain RHA1) GN=ssuB2 PE=3 SV=1 202 375 7.0E-13
sp|Q667L9|METN2_YERPS Methionine import ATP-binding protein MetN 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN2 PE=3 SV=1 196 361 8.0E-13
sp|Q7UBD0|MALK_SHIFL Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri GN=malK PE=3 SV=1 196 369 8.0E-13
sp|Q3YUV0|MALK_SHISS Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella sonnei (strain Ss046) GN=malK PE=3 SV=1 196 369 8.0E-13
sp|Q1R3Q1|MALK_ECOUT Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain UTI89 / UPEC) GN=malK PE=1 SV=2 196 369 8.0E-13
sp|P68187|MALK_ECOLI Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1 196 369 8.0E-13
sp|P68188|MALK_ECO57 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O157:H7 GN=malK PE=3 SV=1 196 369 8.0E-13
sp|Q0SXQ1|MALK_SHIF8 Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri serotype 5b (strain 8401) GN=malK PE=3 SV=1 196 369 8.0E-13
sp|Q0TA26|MALK_ECOL5 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=malK PE=3 SV=1 196 369 8.0E-13
sp|Q8FB37|MALK_ECOL6 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=malK PE=3 SV=2 196 369 9.0E-13
sp|Q664X5|MALK_YERPS Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=malK PE=3 SV=1 197 361 1.0E-12
sp|Q1CNR8|MALK_YERPN Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=malK PE=3 SV=1 197 361 1.0E-12
sp|Q8ZAS8|MALK_YERPE Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis GN=malK PE=3 SV=1 197 361 1.0E-12
sp|Q1CC21|MALK_YERPA Maltose/maltodextrin import ATP-binding protein MalK OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=malK PE=3 SV=1 197 361 1.0E-12
sp|Q11D92|THIQ_CHESB Thiamine import ATP-binding protein ThiQ OS=Chelativorans sp. (strain BNC1) GN=thiQ PE=3 SV=1 202 358 2.0E-12
sp|P70970|ECFA2_BACSU Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus subtilis (strain 168) GN=ecfAB PE=3 SV=1 197 361 2.0E-12
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 198 363 3.0E-12
sp|Q7N8M2|METN_PHOLL Methionine import ATP-binding protein MetN OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=metN PE=3 SV=1 167 352 3.0E-12
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 198 364 3.0E-12
sp|Q8Z1U0|MALK_SALTI Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhi GN=malK PE=3 SV=1 196 369 3.0E-12
sp|Q5PKZ8|MALK_SALPA Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=malK PE=3 SV=1 196 369 4.0E-12
sp|P19566|MALK_SALTY Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=malK PE=1 SV=3 196 369 4.0E-12
sp|Q57GZ7|MALK_SALCH Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella choleraesuis (strain SC-B67) GN=malK PE=3 SV=1 196 369 4.0E-12
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 158 363 4.0E-12
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 182 347 4.0E-12
sp|Q38WL5|METN_LACSS Methionine import ATP-binding protein MetN OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metN PE=3 SV=1 190 358 4.0E-12
sp|Q9KIF7|OPUAA_LACLA Glycine betaine transport ATP-binding protein OpuAA OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=opuAA PE=3 SV=1 162 361 4.0E-12
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 198 363 5.0E-12
sp|Q1CFH7|METN2_YERPN Methionine import ATP-binding protein MetN 2 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=metN2 PE=3 SV=1 196 361 5.0E-12
sp|Q8ZH38|METN1_YERPE Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis GN=metN1 PE=3 SV=1 196 361 5.0E-12
sp|Q1CAK4|METN1_YERPA Methionine import ATP-binding protein MetN 1 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=metN1 PE=3 SV=1 196 361 5.0E-12
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 195 357 6.0E-12
sp|Q8U648|SSUB2_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB2 PE=3 SV=2 202 352 6.0E-12
sp|Q8PP41|SSUB1_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1 199 347 6.0E-12
sp|Q6F9A8|CYSA_ACIAD Sulfate/thiosulfate import ATP-binding protein CysA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysA PE=3 SV=1 198 364 6.0E-12
sp|Q6D1C4|METN3_PECAS Methionine import ATP-binding protein MetN 3 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN3 PE=3 SV=1 196 392 6.0E-12
sp|P37624|RBBA_ECOLI Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3 197 364 6.0E-12
sp|Q88UV2|METN2_LACPL Methionine import ATP-binding protein MetN 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metN2 PE=3 SV=1 196 364 7.0E-12
sp|Q2YKZ7|Y2993_BRUA2 Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1 202 364 7.0E-12
sp|Q578M5|Y2787_BRUAB Putative ATP-binding protein BruAb2_0487 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0487 PE=3 SV=1 202 364 7.0E-12
sp|Q8FVT0|Y3745_BRUSU Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1 202 364 8.0E-12
sp|Q576E0|Y3423_BRUAB Putative ATP-binding protein BruAb2_1123 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_1123 PE=3 SV=1 197 348 8.0E-12
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 198 372 9.0E-12
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 198 372 9.0E-12
sp|Q5PJL1|UGPC_SALPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ugpC PE=3 SV=1 199 364 9.0E-12
sp|D5AQY6|NIKO_RHOCB Nickel import ATP-binding protein NikO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=nikO PE=1 SV=1 196 364 1.0E-11
sp|Q8DRS0|ECFA2_STRMU Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=ecfA2 PE=3 SV=1 198 357 1.0E-11
sp|Q981Y8|SSUB2_RHILO Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Rhizobium loti (strain MAFF303099) GN=ssuB2 PE=3 SV=1 202 350 1.0E-11
sp|Q8FUN3|Y4187_BRUSU Putative ATP-binding protein BRA1187/BS1330_II1178 OS=Brucella suis biovar 1 (strain 1330) GN=BRA1187 PE=3 SV=1 197 348 1.0E-11
sp|Q2YJB5|Y3647_BRUA2 Putative ATP-binding protein BAB2_1147 OS=Brucella abortus (strain 2308) GN=BAB2_1147 PE=3 SV=1 197 348 1.0E-11
sp|Q57IS3|UGPC_SALCH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella choleraesuis (strain SC-B67) GN=ugpC PE=3 SV=1 199 364 1.0E-11
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 188 363 1.0E-11
sp|Q8Z990|METN1_SALTI Methionine import ATP-binding protein MetN 1 OS=Salmonella typhi GN=metN1 PE=3 SV=1 162 352 1.0E-11
sp|Q9I6T2|POTA1_PSEAE Spermidine/putrescine import ATP-binding protein PotA 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA1 PE=3 SV=1 192 388 1.0E-11
sp|Q67JX4|ECFA2_SYMTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ecfA2 PE=3 SV=1 198 364 1.0E-11
sp|Q5PID0|METN1_SALPA Methionine import ATP-binding protein MetN 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN1 PE=3 SV=1 162 352 2.0E-11
sp|Q57T09|METN1_SALCH Methionine import ATP-binding protein MetN 1 OS=Salmonella choleraesuis (strain SC-B67) GN=metN1 PE=3 SV=2 162 352 2.0E-11
sp|Q8ZLF4|UGPC_SALTY sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ugpC PE=1 SV=1 199 364 2.0E-11
sp|Q9RR46|GBUA_LISM4 Glycine betaine/carnitine transport ATP-binding protein GbuA OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=gbuA PE=1 SV=1 162 361 2.0E-11
sp|Q32K28|THIQ_SHIDS Thiamine import ATP-binding protein ThiQ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=thiQ PE=3 SV=1 202 361 2.0E-11
sp|Q8ZRM9|METN1_SALTY Methionine import ATP-binding protein MetN 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN1 PE=3 SV=1 162 352 2.0E-11
sp|Q2NRN5|METN_SODGM Methionine import ATP-binding protein MetN OS=Sodalis glossinidius (strain morsitans) GN=metN PE=3 SV=1 194 378 2.0E-11
sp|Q8Z245|UGPC_SALTI sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella typhi GN=ugpC PE=3 SV=1 199 364 2.0E-11
sp|Q82CD3|SSUB2_STRAW Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ssuB2 PE=3 SV=1 202 352 2.0E-11
sp|Q0T8D1|THIQ_SHIF8 Thiamine import ATP-binding protein ThiQ OS=Shigella flexneri serotype 5b (strain 8401) GN=thiQ PE=3 SV=1 202 361 2.0E-11
sp|Q8TUR7|PSTB_METKA Phosphate import ATP-binding protein PstB OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pstB PE=3 SV=1 198 361 2.0E-11
sp|Q8DZJ0|POTA_STRA5 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=potA PE=3 SV=1 197 364 2.0E-11
sp|Q8E554|POTA_STRA3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=potA PE=3 SV=1 197 364 2.0E-11
sp|Q3K0Y6|POTA_STRA1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=potA PE=3 SV=1 197 364 2.0E-11
sp|Q0BUR6|SSUB_GRABC Aliphatic sulfonates import ATP-binding protein SsuB OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=ssuB PE=3 SV=1 202 354 2.0E-11
sp|Q326G9|THIQ_SHIBS Thiamine import ATP-binding protein ThiQ OS=Shigella boydii serotype 4 (strain Sb227) GN=thiQ PE=3 SV=1 202 361 2.0E-11
sp|Q5HQ70|POTA_STAEQ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=potA PE=3 SV=1 183 364 2.0E-11
sp|Q7N986|MALK_PHOLL Maltose/maltodextrin import ATP-binding protein MalK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=malK PE=3 SV=1 200 361 2.0E-11
sp|Q8E9I8|PSTB2_SHEON Phosphate import ATP-binding protein PstB 2 OS=Shewanella oneidensis (strain MR-1) GN=pstB2 PE=3 SV=1 176 369 2.0E-11
sp|Q9M0G9|AB24B_ARATH ABC transporter B family member 24, mitochondrial OS=Arabidopsis thaliana GN=ABCB24 PE=2 SV=1 202 357 3.0E-11
sp|Q73YZ5|SSUB_MYCPA Aliphatic sulfonates import ATP-binding protein SsuB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=ssuB PE=3 SV=1 199 350 3.0E-11
sp|A0QFE1|SSUB_MYCA1 Aliphatic sulfonates import ATP-binding protein SsuB OS=Mycobacterium avium (strain 104) GN=ssuB PE=3 SV=1 199 350 3.0E-11
sp|P97027|SSUB_BACSU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus subtilis (strain 168) GN=ssuB PE=1 SV=4 199 348 3.0E-11
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 198 364 3.0E-11
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 198 364 3.0E-11
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 198 364 3.0E-11
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 198 364 3.0E-11
sp|Q7CN92|POTA_STRP8 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1 198 364 3.0E-11
sp|Q99ZS8|POTA_STRP1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1 198 364 3.0E-11
sp|P31548|THIQ_ECOLI Thiamine import ATP-binding protein ThiQ OS=Escherichia coli (strain K12) GN=thiQ PE=1 SV=2 202 361 3.0E-11
sp|Q6GEL4|ECFA2_STAAR Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MRSA252) GN=ecfA2 PE=3 SV=1 198 364 4.0E-11
sp|Q885N4|SSUB1_PSESM Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB1 PE=3 SV=1 202 391 4.0E-11
sp|Q47T99|POTA_THEFY Spermidine/putrescine import ATP-binding protein PotA OS=Thermobifida fusca (strain YX) GN=potA PE=3 SV=1 161 363 4.0E-11
sp|Q8D653|CYSA_VIBVU Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio vulnificus (strain CMCP6) GN=cysA PE=3 SV=1 198 361 4.0E-11
sp|Q08381|MODC_RHOCA Molybdenum import ATP-binding protein ModC OS=Rhodobacter capsulatus GN=modC PE=3 SV=1 203 356 4.0E-11
sp|Q13RD3|SSUB2_BURXL Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Burkholderia xenovorans (strain LB400) GN=ssuB2 PE=3 SV=1 197 355 4.0E-11
sp|Q6LV32|THIQ_PHOPR Thiamine import ATP-binding protein ThiQ OS=Photobacterium profundum GN=thiQ PE=3 SV=2 162 361 4.0E-11
sp|Q47RE8|METN_THEFY Methionine import ATP-binding protein MetN OS=Thermobifida fusca (strain YX) GN=metN PE=3 SV=2 196 361 4.0E-11
sp|Q4ZQE3|SSUB2_PSEU2 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ssuB2 PE=3 SV=1 202 389 4.0E-11
sp|Q12XW6|PSTB_METBU Phosphate import ATP-binding protein PstB OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pstB PE=3 SV=1 198 358 5.0E-11
sp|Q881U6|SSUB2_PSESM Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ssuB2 PE=3 SV=1 199 347 5.0E-11
sp|Q8PYH5|Y887_METMA Putative ABC transporter ATP-binding protein MM_0887 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0887 PE=3 SV=1 190 361 5.0E-11
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 198 364 5.0E-11
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 198 364 5.0E-11
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 198 364 5.0E-11
sp|A0RFA4|SSUB_BACAH Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus thuringiensis (strain Al Hakam) GN=ssuB PE=3 SV=2 196 348 6.0E-11
sp|P0A191|LIVF_SALTY High-affinity branched-chain amino acid transport ATP-binding protein LivF OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=livF PE=3 SV=1 195 350 6.0E-11
sp|P0A192|LIVF_SALTI High-affinity branched-chain amino acid transport ATP-binding protein LivF OS=Salmonella typhi GN=livF PE=3 SV=1 195 350 6.0E-11
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 198 364 6.0E-11
sp|Q63A38|SSUB_BACCZ Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ZK / E33L) GN=ssuB PE=3 SV=1 196 348 6.0E-11
sp|Q83MG3|THIQ_SHIFL Thiamine import ATP-binding protein ThiQ OS=Shigella flexneri GN=thiQ PE=3 SV=4 202 361 6.0E-11
sp|Q8DUF7|POTA_STRMU Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=potA PE=3 SV=1 197 364 7.0E-11
sp|Q5YYR7|SSUB2_NOCFA Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Nocardia farcinica (strain IFM 10152) GN=ssuB2 PE=3 SV=1 199 352 7.0E-11
sp|Q6HHI7|SSUB_BACHK Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ssuB PE=3 SV=1 196 348 8.0E-11
sp|Q8NR42|SSUB_CORGL Aliphatic sulfonates import ATP-binding protein SsuB OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ssuB PE=1 SV=1 202 352 8.0E-11
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 177 364 8.0E-11
sp|Q736E0|SSUB_BACC1 Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ssuB PE=3 SV=1 184 348 8.0E-11
sp|Q81P94|SSUB_BACAN Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus anthracis GN=ssuB PE=3 SV=1 196 348 8.0E-11
sp|Q9CNP9|THIQ_PASMU Thiamine import ATP-binding protein ThiQ OS=Pasteurella multocida (strain Pm70) GN=thiQ PE=3 SV=1 201 366 9.0E-11
sp|Q8CPN0|POTA_STAES Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=potA PE=3 SV=1 183 364 9.0E-11
sp|Q8XA06|THIQ_ECO57 Thiamine import ATP-binding protein ThiQ OS=Escherichia coli O157:H7 GN=thiQ PE=3 SV=1 202 361 1.0E-10
sp|Q1QSE9|PSTB2_CHRSD Phosphate import ATP-binding protein PstB 2 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pstB2 PE=3 SV=1 198 352 1.0E-10
sp|Q74L62|ECFA1_LACJO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=ecfA1 PE=3 SV=1 196 361 1.0E-10
sp|Q7MKU3|POTA_VIBVY Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain YJ016) GN=potA PE=3 SV=2 202 407 1.0E-10
sp|Q8D9J4|POTA_VIBVU Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain CMCP6) GN=potA PE=3 SV=1 202 407 1.0E-10
sp|Q81C68|SSUB_BACCR Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ssuB PE=3 SV=1 196 348 1.0E-10
sp|Q5YRK2|SSUB3_NOCFA Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Nocardia farcinica (strain IFM 10152) GN=ssuB3 PE=3 SV=1 199 352 1.0E-10
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 198 363 1.0E-10
sp|Q9FUT3|AB23B_ARATH ABC transporter B family member 23, mitochondrial OS=Arabidopsis thaliana GN=ABCB23 PE=2 SV=1 202 366 1.0E-10
sp|Q7UP21|PSTB_RHOBA Phosphate import ATP-binding protein PstB OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=pstB PE=3 SV=1 198 361 1.0E-10
sp|Q1AS06|POTA_RUBXD Spermidine/putrescine import ATP-binding protein PotA OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=potA PE=3 SV=1 197 363 1.0E-10
sp|Q48FT0|SSUB2_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB2 PE=3 SV=1 202 352 1.0E-10
sp|Q8FCQ2|UGPC_ECOL6 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ugpC PE=3 SV=2 199 428 2.0E-10
sp|A1JIE0|UGPC_YERE8 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ugpC PE=3 SV=1 199 364 2.0E-10
sp|Q1R5H8|UGPC_ECOUT sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain UTI89 / UPEC) GN=ugpC PE=3 SV=2 199 428 2.0E-10
sp|A1AGY1|UGPC_ECOK1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O1:K1 / APEC GN=ugpC PE=3 SV=1 199 428 2.0E-10
sp|P22731|LIVF_ECOLI High-affinity branched-chain amino acid transport ATP-binding protein LivF OS=Escherichia coli (strain K12) GN=livF PE=1 SV=2 195 350 2.0E-10
sp|Q92L31|THIQ_RHIME Thiamine import ATP-binding protein ThiQ OS=Rhizobium meliloti (strain 1021) GN=thiQ PE=3 SV=1 206 354 2.0E-10
sp|P54592|YHCH_BACSU Uncharacterized ABC transporter ATP-binding protein YhcH OS=Bacillus subtilis (strain 168) GN=yhcH PE=3 SV=1 199 352 2.0E-10
sp|Q2YYM5|ECFA2_STAAB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ecfA2 PE=3 SV=1 198 364 2.0E-10
sp|Q65P76|ECFA2_BACLD Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ecfA2 PE=3 SV=1 197 411 2.0E-10
sp|Q146E7|TAUB1_BURXL Taurine import ATP-binding protein TauB 1 OS=Burkholderia xenovorans (strain LB400) GN=tauB1 PE=3 SV=1 187 357 2.0E-10
sp|Q7A088|ECFA2_STAAW Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MW2) GN=ecfA2 PE=3 SV=1 198 364 2.0E-10
sp|Q6G7A0|ECFA2_STAAS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain MSSA476) GN=ecfA2 PE=3 SV=1 198 364 2.0E-10
sp|Q7A471|ECFA2_STAAN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain N315) GN=ecfA2 PE=1 SV=1 198 364 2.0E-10
sp|Q99S48|ECFA2_STAAM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ecfA2 PE=3 SV=1 198 364 2.0E-10
sp|Q5HDY7|ECFA2_STAAC Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain COL) GN=ecfA2 PE=3 SV=1 198 364 2.0E-10
sp|Q2FW35|ECFA2_STAA8 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain NCTC 8325) GN=ecfA2 PE=3 SV=1 198 364 2.0E-10
sp|Q2FER8|ECFA2_STAA3 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus aureus (strain USA300) GN=ecfA2 PE=3 SV=1 198 364 2.0E-10
sp|Q3Z5U5|THIQ_SHISS Thiamine import ATP-binding protein ThiQ OS=Shigella sonnei (strain Ss046) GN=thiQ PE=3 SV=1 202 361 2.0E-10
sp|O34756|YJKB_BACSU Putative ABC transporter ATP-binding protein YjkB OS=Bacillus subtilis (strain 168) GN=yjkB PE=3 SV=1 205 352 2.0E-10
sp|Q0TC10|UGPC_ECOL5 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ugpC PE=3 SV=1 199 407 2.0E-10
sp|Q6XYZ4|ECFA1_SPIKU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Spiroplasma kunkelii GN=ecfA1 PE=3 SV=1 198 361 2.0E-10
sp|Q0SRL2|POTA_CLOPS Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain SM101 / Type A) GN=potA PE=3 SV=2 202 357 2.0E-10
sp|Q2K164|TAUB_RHIEC Taurine import ATP-binding protein TauB OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tauB PE=3 SV=1 185 348 2.0E-10
sp|Q47087|CBRD_DICD3 Achromobactin transport ATP-binding protein CbrD OS=Dickeya dadantii (strain 3937) GN=cbrD PE=3 SV=2 199 364 2.0E-10
sp|Q48QM3|ECFA2_STRPM Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=ecfA2 PE=3 SV=1 198 357 2.0E-10
sp|P0CZ27|ECFA2_STRPQ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=ecfA2 PE=3 SV=1 198 357 3.0E-10
sp|A2RH10|ECFA2_STRPG Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=ecfA2 PE=3 SV=1 198 357 3.0E-10
sp|Q1J450|ECFA2_STRPF Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=ecfA2 PE=3 SV=1 198 357 3.0E-10
sp|Q1JEC9|ECFA2_STRPD Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=ecfA2 PE=3 SV=1 198 357 3.0E-10
sp|Q1JJD0|ECFA2_STRPC Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=ecfA2 PE=3 SV=1 198 357 3.0E-10
sp|Q1J983|ECFA2_STRPB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=ecfA2 PE=3 SV=1 198 357 3.0E-10
sp|Q7CMM8|ECFA2_STRP8 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=ecfA2 PE=3 SV=1 198 357 3.0E-10
sp|Q5X9B6|ECFA2_STRP6 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=ecfA2 PE=3 SV=1 198 357 3.0E-10
sp|P0CZ26|ECFA2_STRP3 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=ecfA2 PE=3 SV=1 198 357 3.0E-10
sp|Q99XI2|ECFA2_STRP1 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pyogenes serotype M1 GN=ecfA2 PE=3 SV=1 198 357 3.0E-10
sp|Q045Z8|ECFA1_LACGA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=ecfA1 PE=3 SV=1 187 361 3.0E-10
sp|Q8H1R4|AB10I_ARATH ABC transporter I family member 10, chloroplastic OS=Arabidopsis thaliana GN=ABCI10 PE=2 SV=1 184 363 3.0E-10
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 199 364 3.0E-10
sp|Q7NIW1|CYSA_GLOVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1 198 363 3.0E-10
sp|Q1M7R4|TAUB_RHIL3 Taurine import ATP-binding protein TauB OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=tauB PE=3 SV=1 185 348 3.0E-10
sp|Q2J1U0|MODC_RHOP2 Molybdenum import ATP-binding protein ModC OS=Rhodopseudomonas palustris (strain HaA2) GN=modC PE=3 SV=1 203 362 3.0E-10
sp|Q5WET7|PSTB2_BACSK Phosphate import ATP-binding protein PstB 2 OS=Bacillus clausii (strain KSM-K16) GN=pstB2 PE=3 SV=1 198 352 3.0E-10
sp|Q28K97|TAUB_JANSC Taurine import ATP-binding protein TauB OS=Jannaschia sp. (strain CCS1) GN=tauB PE=3 SV=1 196 348 3.0E-10
sp|Q2YAD6|POTA_NITMU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=potA PE=3 SV=1 198 353 4.0E-10
sp|P47426|ECFA2_MYCGE Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ecfA2 PE=3 SV=1 179 361 4.0E-10
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 176 347 4.0E-10
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 187 361 4.0E-10
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 187 361 4.0E-10
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 187 361 4.0E-10
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 187 361 4.0E-10
sp|A0B1M7|RBSA2_BURCH Ribose import ATP-binding protein RbsA 2 OS=Burkholderia cenocepacia (strain HI2424) GN=rbsA2 PE=3 SV=1 196 377 4.0E-10
sp|Q1BPL3|RBSA2_BURCA Ribose import ATP-binding protein RbsA 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=rbsA2 PE=3 SV=1 196 377 4.0E-10
sp|Q0S0X2|SSUB3_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Rhodococcus jostii (strain RHA1) GN=ssuB3 PE=3 SV=1 202 350 5.0E-10
sp|Q6GIH9|METN2_STAAR Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MRSA252) GN=metN2 PE=3 SV=1 190 356 5.0E-10
sp|Q65QT6|MALK_MANSM Maltose/maltodextrin import ATP-binding protein MalK OS=Mannheimia succiniciproducens (strain MBEL55E) GN=malK PE=3 SV=1 200 361 5.0E-10
sp|Q3A6U0|PSTB_PELCD Phosphate import ATP-binding protein PstB OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pstB PE=3 SV=1 184 361 6.0E-10
sp|P17328|PROV_SALTY Glycine betaine/L-proline transport ATP-binding protein ProV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=proV PE=3 SV=2 199 369 6.0E-10
sp|Q63JZ3|TAUB_BURPS Taurine import ATP-binding protein TauB OS=Burkholderia pseudomallei (strain K96243) GN=tauB PE=3 SV=1 176 348 6.0E-10
sp|Q8XIZ5|POTA_CLOPE Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain 13 / Type A) GN=potA PE=3 SV=1 202 357 6.0E-10
sp|Q0TNZ3|POTA_CLOP1 Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=potA PE=3 SV=1 202 357 6.0E-10
sp|P42246|YCBN_BACSU Uncharacterized ABC transporter ATP-binding protein YcbN OS=Bacillus subtilis (strain 168) GN=ycbN PE=3 SV=4 198 352 6.0E-10
sp|Q92G36|ZNUC_RICCN Zinc import ATP-binding protein ZnuC OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=znuC PE=3 SV=1 197 374 6.0E-10
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 202 385 6.0E-10
sp|Q3ATA4|PSTB_CHLCH Phosphate import ATP-binding protein PstB OS=Chlorobium chlorochromatii (strain CaD3) GN=pstB PE=3 SV=1 177 361 7.0E-10
sp|P48243|GLUA_CORGL Glutamate transport ATP-binding protein GluA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gluA PE=3 SV=2 198 352 7.0E-10
sp|Q97KS6|POTA_CLOAB Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=potA PE=3 SV=1 198 357 7.0E-10
sp|Q92XW1|CYSA1_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Rhizobium meliloti (strain 1021) GN=cysA1 PE=3 SV=1 188 363 7.0E-10
sp|Q471U2|TAUB_CUPPJ Taurine import ATP-binding protein TauB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tauB PE=3 SV=1 176 357 7.0E-10
sp|P14175|PROV_ECOLI Glycine betaine/L-proline transport ATP-binding protein ProV OS=Escherichia coli (strain K12) GN=proV PE=1 SV=1 199 369 7.0E-10
sp|A0KE71|SSUB2_BURCH Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Burkholderia cenocepacia (strain HI2424) GN=ssuB2 PE=3 SV=1 175 353 7.0E-10
sp|Q1BG75|SSUB2_BURCA Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=ssuB2 PE=3 SV=1 175 353 7.0E-10
sp|Q3JKX3|TAUB_BURP1 Taurine import ATP-binding protein TauB OS=Burkholderia pseudomallei (strain 1710b) GN=tauB PE=3 SV=1 176 348 7.0E-10
sp|Q62AW4|TAUB_BURMA Taurine import ATP-binding protein TauB OS=Burkholderia mallei (strain ATCC 23344) GN=tauB PE=3 SV=1 176 348 7.0E-10
sp|Q8NXH5|METN2_STAAW Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MW2) GN=metN2 PE=3 SV=1 190 356 8.0E-10
sp|Q6GB18|METN2_STAAS Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MSSA476) GN=metN2 PE=3 SV=1 190 356 8.0E-10
sp|Q5HHK4|METN2_STAAC Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain COL) GN=metN2 PE=3 SV=1 190 356 8.0E-10
sp|Q2FZZ2|METN2_STAA8 Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain NCTC 8325) GN=metN2 PE=3 SV=1 190 356 8.0E-10
sp|Q2FII2|METN2_STAA3 Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain USA300) GN=metN2 PE=3 SV=1 190 356 8.0E-10
sp|Q8X8K4|YCJV_ECO57 Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O157:H7 GN=ycjV PE=3 SV=1 196 357 8.0E-10
sp|Q2YWP2|METN2_STAAB Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=metN2 PE=3 SV=1 190 356 8.0E-10
sp|Q9TKX3|CYSA_NEPOL Sulfate/thiosulfate import ATP-binding protein CysA OS=Nephroselmis olivacea GN=cysA PE=3 SV=1 198 363 8.0E-10
sp|Q8FHR3|YCJV_ECOL6 Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ycjV PE=3 SV=1 196 357 8.0E-10
sp|Q0TI47|YCJV_ECOL5 Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ycjV PE=3 SV=2 196 357 8.0E-10
sp|P77481|YCJV_ECOLI Putative uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli (strain K12) GN=ycjV PE=5 SV=2 196 357 8.0E-10
sp|Q2YKR8|UGPC_BRUA2 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus (strain 2308) GN=ugpC PE=3 SV=1 196 364 8.0E-10
sp|Q7A6M2|METN2_STAAN Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain N315) GN=metN2 PE=1 SV=1 190 356 9.0E-10
sp|Q99VG8|METN2_STAAM Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metN2 PE=1 SV=1 190 356 9.0E-10
sp|Q6F9P2|METN2_ACIAD Methionine import ATP-binding protein MetN 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN2 PE=3 SV=1 194 361 9.0E-10
sp|Q8YCB1|UGPC_BRUME sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=ugpC PE=3 SV=1 196 364 9.0E-10
sp|Q5QU36|MSBA_IDILO Lipid A export ATP-binding/permease protein MsbA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=msbA PE=3 SV=1 187 379 9.0E-10
sp|Q8FW07|UGPC_BRUSU sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella suis biovar 1 (strain 1330) GN=ugpC PE=3 SV=1 196 364 1.0E-09
sp|Q578E9|UGPC_BRUAB sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Brucella abortus biovar 1 (strain 9-941) GN=ugpC PE=3 SV=1 196 364 1.0E-09
sp|Q8UBY6|THIQ_AGRFC Thiamine import ATP-binding protein ThiQ OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=thiQ PE=3 SV=2 201 361 1.0E-09
sp|Q1B8U4|SSUB_MYCSS Aliphatic sulfonates import ATP-binding protein SsuB OS=Mycobacterium sp. (strain MCS) GN=ssuB PE=3 SV=1 202 350 1.0E-09
sp|Q1WUX2|PSTB1_LACS1 Phosphate import ATP-binding protein PstB 1 OS=Lactobacillus salivarius (strain UCC118) GN=pstB1 PE=3 SV=1 184 352 1.0E-09
sp|P19844|NOSF_PSEST Copper transport ATP-binding protein NosF OS=Pseudomonas stutzeri GN=nosF PE=3 SV=1 196 366 1.0E-09
sp|Q5MZ53|CMPD_SYNP6 Bicarbonate transport ATP-binding protein CmpD OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=cmpD PE=3 SV=1 192 350 1.0E-09
sp|Q55108|CMPD_SYNE7 Bicarbonate transport ATP-binding protein CmpD OS=Synechococcus elongatus (strain PCC 7942) GN=cmpD PE=1 SV=1 192 350 1.0E-09
sp|Q1RC47|YCJV_ECOUT Uncharacterized ABC transporter ATP-binding protein YcjV OS=Escherichia coli (strain UTI89 / UPEC) GN=ycjV PE=4 SV=1 196 357 1.0E-09
sp|Q1RGL1|ZNUC_RICBR Zinc import ATP-binding protein ZnuC OS=Rickettsia bellii (strain RML369-C) GN=znuC PE=3 SV=1 197 374 1.0E-09
sp|Q3B3H7|PSTB_CHLL7 Phosphate import ATP-binding protein PstB OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=pstB PE=3 SV=1 198 369 1.0E-09
sp|Q39LW7|SSUB2_BURL3 Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ssuB2 PE=3 SV=1 201 348 1.0E-09
sp|A0LUE6|POTA_ACIC1 Spermidine/putrescine import ATP-binding protein PotA OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=potA PE=3 SV=1 196 363 1.0E-09
sp|Q0B7X0|RBSA2_BURCM Ribose import ATP-binding protein RbsA 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rbsA2 PE=3 SV=2 196 385 1.0E-09
sp|Q6CZ34|UGPC_PECAS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ugpC PE=3 SV=1 199 364 1.0E-09
sp|Q1M8R6|UGPC2_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC2 PE=3 SV=1 195 364 1.0E-09
sp|Q01937|LACK_RHIRD Lactose transport ATP-binding protein LacK OS=Rhizobium radiobacter GN=lacK PE=3 SV=1 199 363 1.0E-09
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 176 347 1.0E-09
sp|Q1RGD0|THIQ_ECOUT Thiamine import ATP-binding protein ThiQ OS=Escherichia coli (strain UTI89 / UPEC) GN=thiQ PE=3 SV=2 202 361 1.0E-09
sp|Q65M64|SSUB_BACLD Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ssuB PE=3 SV=1 199 348 1.0E-09
sp|P46341|PSTB2_BACSU Phosphate import ATP-binding protein PstB 2 OS=Bacillus subtilis (strain 168) GN=pstB2 PE=3 SV=1 184 361 2.0E-09
sp|Q4KK16|TAUB_PSEF5 Taurine import ATP-binding protein TauB OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tauB PE=3 SV=1 194 348 2.0E-09
sp|Q2RFS8|ECFA_MOOTA Energy-coupling factor transporter ATP-binding protein EcfA OS=Moorella thermoacetica (strain ATCC 39073) GN=ecfA PE=3 SV=1 192 361 2.0E-09
sp|P46920|OPUAA_BACSU Glycine betaine transport ATP-binding protein OpuAA OS=Bacillus subtilis (strain 168) GN=opuAA PE=1 SV=3 162 361 2.0E-09
sp|Q30V33|POTA_DESAG Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio alaskensis (strain G20) GN=potA PE=3 SV=1 198 369 2.0E-09
sp|Q8FL82|THIQ_ECOL6 Thiamine import ATP-binding protein ThiQ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=thiQ PE=3 SV=2 202 361 2.0E-09
sp|Q58664|LIVF_METJA Probable branched-chain amino acid transport ATP-binding protein LivF OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=livF PE=3 SV=2 206 361 2.0E-09
sp|Q1CNC6|UGPC_YERPN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ugpC PE=3 SV=1 199 364 2.0E-09
sp|Q74R28|UGPC_YERPE sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis GN=ugpC PE=3 SV=1 199 364 2.0E-09
sp|Q1CBH2|UGPC_YERPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ugpC PE=3 SV=1 199 364 2.0E-09
sp|Q13GD4|SSUB3_BURXL Aliphatic sulfonates import ATP-binding protein SsuB 3 OS=Burkholderia xenovorans (strain LB400) GN=ssuB3 PE=3 SV=1 197 355 2.0E-09
sp|Q9ZCC4|ZNUC_RICPR Zinc import ATP-binding protein ZnuC OS=Rickettsia prowazekii (strain Madrid E) GN=znuC PE=3 SV=1 199 341 2.0E-09
sp|Q98FA5|THIQ_RHILO Thiamine import ATP-binding protein ThiQ OS=Rhizobium loti (strain MAFF303099) GN=thiQ PE=3 SV=1 210 388 2.0E-09
sp|Q0TLS2|THIQ_ECOL5 Thiamine import ATP-binding protein ThiQ OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=thiQ PE=3 SV=1 202 361 2.0E-09
sp|Q7NWX3|CYSA2_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA2 PE=3 SV=1 197 361 2.0E-09
sp|Q398W2|RBSA2_BURL3 Ribose import ATP-binding protein RbsA 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rbsA2 PE=3 SV=1 196 377 3.0E-09
sp|Q07756|NODI_AZOC5 Nod factor export ATP-binding protein I OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodI PE=3 SV=1 191 354 3.0E-09
sp|Q4UJW5|ZNUC_RICFE Zinc import ATP-binding protein ZnuC OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=znuC PE=3 SV=1 197 374 3.0E-09
sp|Q9KXJ6|Y2324_STRCO Putative ABC transporter ATP-binding protein SCO2324 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO2324 PE=3 SV=1 193 361 3.0E-09
sp|Q8R9I2|PSTB2_CALS4 Phosphate import ATP-binding protein PstB 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pstB2 PE=3 SV=1 176 358 3.0E-09
sp|Q8X6U5|UGPC_ECO57 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O157:H7 GN=ugpC PE=3 SV=2 199 364 3.0E-09
sp|P39459|NASD_KLEOX Nitrate transport protein NasD OS=Klebsiella oxytoca GN=nasD PE=3 SV=2 197 362 3.0E-09
sp|Q8Z9I6|THIQ_SALTI Thiamine import ATP-binding protein ThiQ OS=Salmonella typhi GN=thiQ PE=3 SV=1 202 361 3.0E-09
sp|Q57TF5|THIQ_SALCH Thiamine import ATP-binding protein ThiQ OS=Salmonella choleraesuis (strain SC-B67) GN=thiQ PE=3 SV=1 202 361 3.0E-09
sp|Q5FM18|PSTB1_LACAC Phosphate import ATP-binding protein PstB 1 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pstB1 PE=3 SV=1 203 361 3.0E-09
sp|Q82B58|Y5847_STRAW Putative ABC transporter ATP-binding protein SAV_5847 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=SAV_5847 PE=3 SV=1 173 361 3.0E-09
sp|Q2IGQ6|PSTB_ANADE Phosphate import ATP-binding protein PstB OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pstB PE=3 SV=1 197 361 3.0E-09
sp|Q9Z8Q8|METN_CHLPN Methionine import ATP-binding protein MetN OS=Chlamydia pneumoniae GN=metN PE=3 SV=1 197 361 3.0E-09
sp|Q722B1|POTA_LISMF Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serotype 4b (strain F2365) GN=potA PE=3 SV=2 202 364 3.0E-09
sp|Q4L5B3|POTA_STAHJ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=potA PE=3 SV=1 183 364 3.0E-09
sp|A3PRY1|UGPC_RHOS1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ugpC PE=3 SV=1 202 364 3.0E-09
sp|Q5PDF8|THIQ_SALPA Thiamine import ATP-binding protein ThiQ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=thiQ PE=3 SV=1 202 361 3.0E-09
sp|Q65HB9|PSTB2_BACLD Phosphate import ATP-binding protein PstB 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pstB2 PE=3 SV=1 198 352 3.0E-09
sp|Q1IGM2|TAUB_PSEE4 Taurine import ATP-binding protein TauB OS=Pseudomonas entomophila (strain L48) GN=tauB PE=3 SV=1 195 348 3.0E-09
sp|Q8KZR4|TAUB_PSEPU Taurine import ATP-binding protein TauB OS=Pseudomonas putida GN=tauB PE=3 SV=1 195 348 3.0E-09
sp|Q8Y8T6|POTA_LISMO Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=potA PE=3 SV=2 202 364 3.0E-09
sp|Q9X1Z1|ECFA1_THEMA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ecfA1 PE=1 SV=1 198 364 3.0E-09
sp|Q6LSC4|PSTB2_PHOPR Phosphate import ATP-binding protein PstB 2 OS=Photobacterium profundum GN=pstB2 PE=3 SV=1 176 352 3.0E-09
sp|Q3YW77|UGPC_SHISS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella sonnei (strain Ss046) GN=ugpC PE=3 SV=2 199 428 4.0E-09
sp|Q2T751|TAUB_BURTA Taurine import ATP-binding protein TauB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tauB PE=3 SV=1 176 348 4.0E-09
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 199 357 4.0E-09
sp|Q88RA1|TAUB_PSEPK Taurine import ATP-binding protein TauB OS=Pseudomonas putida (strain KT2440) GN=tauB PE=3 SV=1 195 348 4.0E-09
sp|P24693|LPTB_ACIFR Lipopolysaccharide export system ATP-binding protein LptB OS=Acidithiobacillus ferrooxidans GN=lptB PE=3 SV=1 209 363 4.0E-09
sp|Q5WKG4|SSUB1_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Bacillus clausii (strain KSM-K16) GN=ssuB1 PE=3 SV=1 199 352 4.0E-09
sp|Q3KJQ7|TAUB_PSEPF Taurine import ATP-binding protein TauB OS=Pseudomonas fluorescens (strain Pf0-1) GN=tauB PE=3 SV=1 194 348 4.0E-09
sp|A3CRB8|ECFA2_STRSV Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus sanguinis (strain SK36) GN=ecfA2 PE=3 SV=1 202 361 4.0E-09
sp|Q7N8V0|THIQ_PHOLL Thiamine import ATP-binding protein ThiQ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=thiQ PE=3 SV=1 204 356 4.0E-09
sp|Q92DL6|POTA_LISIN Spermidine/putrescine import ATP-binding protein PotA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=potA PE=3 SV=2 202 364 4.0E-09
sp|Q9PQU3|PSTB_UREPA Phosphate import ATP-binding protein PstB OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=pstB PE=3 SV=1 184 358 4.0E-09
sp|Q5HM28|ECFA2_STAEQ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ecfA2 PE=3 SV=1 198 373 4.0E-09
sp|Q89ER4|SSUB_BRADU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=ssuB PE=3 SV=1 199 352 4.0E-09
sp|Q5X627|POTA_LEGPA Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Paris) GN=potA PE=3 SV=1 199 357 5.0E-09
sp|Q9X0Y8|PSTB_THEMA Phosphate import ATP-binding protein PstB OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=pstB PE=3 SV=1 197 369 5.0E-09
sp|Q8U6M1|FBPC_AGRFC Fe(3+) ions import ATP-binding protein FbpC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fbpC PE=3 SV=1 198 363 5.0E-09
sp|Q8CRI7|ECFA2_STAES Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ecfA2 PE=3 SV=1 198 352 5.0E-09
sp|Q38YC1|PSTB2_LACSS Phosphate import ATP-binding protein PstB 2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=pstB2 PE=3 SV=1 257 352 5.0E-09
sp|A0AGP9|POTA_LISW6 Spermidine/putrescine import ATP-binding protein PotA OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=potA PE=3 SV=1 202 364 5.0E-09
sp|Q67RG2|PSTB1_SYMTH Phosphate import ATP-binding protein PstB 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=pstB1 PE=3 SV=1 198 358 5.0E-09
sp|Q97N51|ECFA2_STRPN Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ecfA2 PE=3 SV=1 198 357 5.0E-09
sp|Q8FYU9|THIQ_BRUSU Thiamine import ATP-binding protein ThiQ OS=Brucella suis biovar 1 (strain 1330) GN=thiQ PE=3 SV=1 209 366 6.0E-09
sp|Q8YJ04|THIQ_BRUME Thiamine import ATP-binding protein ThiQ OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=thiQ PE=3 SV=2 209 366 6.0E-09
sp|Q2SVU4|RBSA1_BURTA Ribose import ATP-binding protein RbsA 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rbsA1 PE=3 SV=2 196 350 6.0E-09
sp|Q02592|HMT1_SCHPO Heavy metal tolerance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hmt1 PE=2 SV=3 192 382 6.0E-09
sp|Q50863|RFBB_MYXXA O-antigen export system ATP-binding protein RfbB OS=Myxococcus xanthus GN=rfbB PE=3 SV=1 174 361 6.0E-09
sp|O28882|LIVF_ARCFU Probable branched-chain amino acid transport ATP-binding protein LivF OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=livF PE=3 SV=1 205 361 6.0E-09
sp|Q4KGX6|SSUB1_PSEF5 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ssuB1 PE=3 SV=1 202 352 6.0E-09
sp|Q6F1N1|PSTB_MESFL Phosphate import ATP-binding protein PstB OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=pstB PE=3 SV=1 186 352 6.0E-09
sp|Q38UU0|ECFA2_LACSS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=ecfA2 PE=3 SV=1 197 361 6.0E-09
sp|Q74L61|ECFA2_LACJO Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=ecfA2 PE=3 SV=1 201 361 7.0E-09
sp|Q55463|CMPD_SYNY3 Bicarbonate transport ATP-binding protein CmpD OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cmpD PE=2 SV=1 195 350 7.0E-09
sp|Q3IX40|UGPC_RHOS4 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ugpC PE=3 SV=1 202 364 7.0E-09
sp|Q48C94|TAUB_PSE14 Taurine import ATP-binding protein TauB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tauB PE=3 SV=1 195 355 8.0E-09
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 196 348 8.0E-09
sp|Q65E55|RBSA_BACLD Ribose import ATP-binding protein RbsA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rbsA PE=3 SV=1 202 350 9.0E-09
sp|O28912|PSTB_ARCFU Phosphate import ATP-binding protein PstB OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pstB PE=3 SV=1 197 364 9.0E-09
sp|Q5LVM5|TAUB_RUEPO Taurine import ATP-binding protein TauB OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tauB PE=3 SV=1 196 348 9.0E-09
sp|A0KAV6|TAUB_BURCH Taurine import ATP-binding protein TauB OS=Burkholderia cenocepacia (strain HI2424) GN=tauB PE=3 SV=1 187 355 9.0E-09
sp|Q1BT84|TAUB_BURCA Taurine import ATP-binding protein TauB OS=Burkholderia cenocepacia (strain AU 1054) GN=tauB PE=3 SV=1 187 355 9.0E-09
sp|Q664P8|TAUB_YERPS Taurine import ATP-binding protein TauB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tauB PE=3 SV=1 198 350 9.0E-09
sp|P18813|MALK_ENTAE Maltose/maltodextrin import ATP-binding protein MalK (Fragment) OS=Enterobacter aerogenes GN=malK PE=3 SV=1 196 369 1.0E-08
sp|Q82MV1|SSUB1_STRAW Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ssuB1 PE=3 SV=1 199 361 1.0E-08
sp|Q13KX9|TAUB2_BURXL Taurine import ATP-binding protein TauB 2 OS=Burkholderia xenovorans (strain LB400) GN=tauB2 PE=3 SV=1 187 348 1.0E-08
sp|Q8R9L8|Y1589_CALS4 Putative ABC transporter ATP-binding protein TTE1589 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE1589 PE=3 SV=1 198 366 1.0E-08
sp|Q8DMY0|ECFA2_STRR6 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ecfA2 PE=3 SV=1 198 357 1.0E-08
sp|Q04HV8|ECFA2_STRP2 Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=ecfA2 PE=3 SV=1 198 357 1.0E-08
sp|Q0SK28|SSUB1_RHOJR Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Rhodococcus jostii (strain RHA1) GN=ssuB1 PE=3 SV=1 188 348 1.0E-08
sp|Q9UZU7|PSTB_PYRAB Phosphate import ATP-binding protein PstB OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pstB PE=3 SV=2 198 358 1.0E-08
sp|Q74DN5|Y1281_GEOSL Putative ABC transporter ATP-binding protein GSU1281 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=GSU1281 PE=3 SV=1 198 361 1.0E-08
sp|Q1CCR9|TAUB_YERPN Taurine import ATP-binding protein TauB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tauB PE=3 SV=1 198 350 1.0E-08
sp|Q8ZJD0|TAUB_YERPE Taurine import ATP-binding protein TauB OS=Yersinia pestis GN=tauB PE=3 SV=1 198 350 1.0E-08
sp|Q1C2S1|TAUB_YERPA Taurine import ATP-binding protein TauB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tauB PE=3 SV=1 198 350 1.0E-08
sp|Q4QK92|PSTB_HAEI8 Phosphate import ATP-binding protein PstB OS=Haemophilus influenzae (strain 86-028NP) GN=pstB PE=3 SV=1 177 364 1.0E-08
sp|Q02QM1|PHNC1_PSEAB Phosphonates import ATP-binding protein PhnC 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=phnC1 PE=3 SV=1 198 363 1.0E-08
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 199 357 1.0E-08
sp|Q9KGD6|ECFA2_BACHD Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ecfA2 PE=3 SV=1 197 356 1.0E-08
sp|Q2G2M9|Y2003_STAA8 Putative multidrug export ATP-binding/permease protein SAOUHSC_02003 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02003 PE=3 SV=1 199 367 1.0E-08
sp|Q6GFJ1|Y1956_STAAR Putative multidrug export ATP-binding/permease protein SAR1956 OS=Staphylococcus aureus (strain MRSA252) GN=SAR1956 PE=3 SV=1 199 367 1.0E-08
sp|Q5HEQ8|Y1924_STAAC Putative multidrug export ATP-binding/permease protein SACOL1924 OS=Staphylococcus aureus (strain COL) GN=SACOL1924 PE=3 SV=1 199 367 1.0E-08
sp|Q99T13|Y1866_STAAM Putative multidrug export ATP-binding/permease protein SAV1866 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV1866 PE=1 SV=1 199 367 1.0E-08
sp|Q2FFM9|Y1847_STAA3 Putative multidrug export ATP-binding/permease protein SAUSA300_1847 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_1847 PE=3 SV=1 199 367 1.0E-08
sp|Q7A0J1|Y1806_STAAW Putative multidrug export ATP-binding/permease protein MW1806 OS=Staphylococcus aureus (strain MW2) GN=MW1806 PE=3 SV=1 199 367 1.0E-08
sp|Q6G868|Y1788_STAAS Putative multidrug export ATP-binding/permease protein SAS1788 OS=Staphylococcus aureus (strain MSSA476) GN=SAS1788 PE=3 SV=1 199 367 1.0E-08
sp|Q7A4T3|Y1683_STAAN Putative multidrug export ATP-binding/permease protein SA1683 OS=Staphylococcus aureus (strain N315) GN=SA1683 PE=1 SV=1 199 367 1.0E-08
sp|Q2YU20|Y1799_STAAB Putative multidrug export ATP-binding/permease protein SAB1799c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB1799c PE=3 SV=1 199 367 1.0E-08
sp|Q2SZW0|MSBA_BURTA Lipid A export ATP-binding/permease protein MsbA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=msbA PE=3 SV=1 175 375 1.0E-08
sp|P63363|PSTB1_LISMO Phosphate import ATP-binding protein PstB 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pstB1 PE=3 SV=1 198 352 1.0E-08
sp|Q71WT3|PSTB1_LISMF Phosphate import ATP-binding protein PstB 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pstB1 PE=3 SV=1 198 352 1.0E-08
sp|P63364|PSTB1_LISIN Phosphate import ATP-binding protein PstB 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pstB1 PE=3 SV=1 198 352 1.0E-08
sp|Q1WUX1|PSTB2_LACS1 Phosphate import ATP-binding protein PstB 2 OS=Lactobacillus salivarius (strain UCC118) GN=pstB2 PE=3 SV=1 257 361 1.0E-08
sp|Q8Y454|ECFA1_LISMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=ecfA1 PE=3 SV=1 198 361 1.0E-08
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 198 366 1.0E-08
sp|Q6RH47|TAUB_PARPN Taurine import ATP-binding protein TauB OS=Paracoccus pantotrophus GN=tauB PE=3 SV=1 195 348 1.0E-08
sp|Q839D4|ECFA2_ENTFA Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=ecfA2 PE=3 SV=2 198 361 2.0E-08
sp|Q1GIE5|POTA_RUEST Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria sp. (strain TM1040) GN=potA PE=3 SV=1 162 363 2.0E-08
sp|P46342|PSTB1_BACSU Phosphate import ATP-binding protein PstB 1 OS=Bacillus subtilis (strain 168) GN=pstB1 PE=3 SV=1 257 352 2.0E-08
sp|Q65SC9|THIQ_MANSM Thiamine import ATP-binding protein ThiQ OS=Mannheimia succiniciproducens (strain MBEL55E) GN=thiQ PE=3 SV=1 212 350 2.0E-08
sp|Q30YR3|PSTB_DESAG Phosphate import ATP-binding protein PstB OS=Desulfovibrio alaskensis (strain G20) GN=pstB PE=3 SV=1 176 367 2.0E-08
sp|Q65P77|ECFA1_BACLD Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ecfA1 PE=3 SV=1 198 361 2.0E-08
sp|Q39CJ6|TAUB_BURL3 Taurine import ATP-binding protein TauB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tauB PE=3 SV=1 187 355 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATPase activity Yes
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0008144 drug binding No
GO:0003674 molecular_function No
GO:0016462 pyrophosphatase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 39 61 22
3 65 87 22
4 108 130 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5503
MRAGVFANTAAAVVVLHSLLAGLALASFALLCAAPFRRAQLSGITATLAALLLAILAQSITGPGTAAVAVLSALF
APCNYVYFVTLMAHFERDERATSLVDMPPDSSWRLPGIVLWLLLLAQIVLYPLLAAVVERWVHGAAAEGRHVLVA
GEGGAGLGDNAVRLDRLTKVYHPGPLSRLGAALLSFFLGRRPREPVVAVRELSLDVPRGQIVTLLGANGSGKSTT
LDAIAGLHRLSSGSVAVDGTGGLGVAPQKNVLWDDLTVLEHLVRDALARTLSGGQKRKLQLGMMLTGGSAVCCVD
EVSSGLDPLSRRKIWDILLAERGRRTLILTTHFLDEADLLADHIAILSKGTLRAAGSSVELKDRLGGGYKVHVHR
APGSDAAAAAAPDRTPDIEGVHKRRDFDGGVTYVSPTSRLAAQVIGRLDGCGITDYRFSGPTIEDVFLRLAEEIQ
DEQQVGGGDGDGDGDGDGDSPKGVAEKKVVVVQQQQPDLGLMDGTHVGAAGRCTCWPSACPCSRRR*
Coding >Hirsu2|5503
ATGCGCGCCGGCGTCTTCGCCAACACGGCCGCCGCCGTCGTCGTCCTGCACTCGCTGCTGGCCGGCCTCGCCCTC
GCCTCCTTCGCCCTGCTGTGCGCCGCGCCCTTCCGCCGCGCCCAGCTGAGCGGCATCACCGCCACCCTGGCCGCC
CTGCTGCTGGCCATCCTGGCCCAGTCCATCACGGGGCCCGGCACCGCCGCCGTCGCCGTCCTGTCCGCCCTCTTC
GCCCCCTGCAACTACGTCTACTTCGTCACCCTCATGGCCCACTTCGAGCGCGACGAGCGCGCCACCAGCCTCGTC
GACATGCCGCCCGACAGCTCCTGGCGCCTCCCGGGCATCGTCCTGTGGCTGCTGCTGCTCGCCCAGATCGTCCTG
TACCCGCTGCTGGCCGCCGTCGTCGAGCGCTGGGTGCACGGCGCCGCCGCCGAGGGCCGCCACGTGCTCGTCGCC
GGCGAGGGGGGCGCCGGCCTCGGCGACAACGCCGTCCGGCTCGACCGCCTGACCAAGGTCTACCACCCGGGCCCG
CTGTCCCGCCTCGGCGCCGCCCTGCTCTCCTTCTTCCTCGGGCGCCGGCCGCGGGAGCCGGTCGTGGCGGTGCGC
GAGCTGAGCCTGGACGTGCCGCGCGGCCAGATCGTCACGCTGCTGGGCGCCAACGGCAGCGGCAAGAGCACGACG
CTCGACGCCATCGCCGGCCTGCACCGGCTGTCGAGCGGCTCCGTCGCCGTCGACGGCACCGGCGGCCTGGGCGTC
GCGCCGCAGAAGAACGTGCTGTGGGACGACCTGACGGTGCTCGAGCACCTGGTCCGCGACGCCCTCGCCCGCACC
CTGTCGGGCGGCCAGAAGCGCAAGCTGCAGCTGGGCATGATGCTGACGGGCGGCAGCGCCGTCTGCTGCGTCGAC
GAGGTCAGCAGCGGCCTCGACCCGCTGTCGCGCCGCAAGATCTGGGACATCCTGCTGGCCGAGCGCGGCCGCCGC
ACCCTGATCCTGACGACGCACTTCCTCGACGAGGCCGACCTGCTGGCCGACCACATCGCCATCCTCTCCAAGGGC
ACCCTCCGCGCCGCCGGCTCCTCCGTCGAGCTCAAGGACCGCCTGGGCGGCGGCTACAAGGTCCACGTCCACCGG
GCGCCCGGCAGTGACGCCGCCGCCGCCGCCGCCCCGGACCGCACCCCCGACATCGAGGGCGTGCACAAGAGGCGC
GATTTCGACGGCGGCGTCACCTACGTCTCGCCCACGTCCCGCCTGGCGGCCCAGGTCATCGGCCGGCTCGACGGC
TGCGGCATCACCGACTACCGCTTCTCCGGCCCGACCATCGAGGACGTCTTCCTGCGGCTGGCGGAGGAGATCCAG
GACGAGCAGCAGGTGGGCGGAGGCGACGGCGACGGCGACGGCGACGGCGACGGCGACAGCCCCAAGGGCGTCGCC
GAGAAGAAGGTCGTCGTCGTCCAGCAGCAGCAGCCGGACCTGGGCCTCATGGACGGCACGCACGTCGGCGCAGCT
GGACGCTGTACCTGCTGGCCTTCTGCCTGCCCGTGTTCGCGGCGGCGCTGA
Transcript >Hirsu2|5503
ATGCGCGCCGGCGTCTTCGCCAACACGGCCGCCGCCGTCGTCGTCCTGCACTCGCTGCTGGCCGGCCTCGCCCTC
GCCTCCTTCGCCCTGCTGTGCGCCGCGCCCTTCCGCCGCGCCCAGCTGAGCGGCATCACCGCCACCCTGGCCGCC
CTGCTGCTGGCCATCCTGGCCCAGTCCATCACGGGGCCCGGCACCGCCGCCGTCGCCGTCCTGTCCGCCCTCTTC
GCCCCCTGCAACTACGTCTACTTCGTCACCCTCATGGCCCACTTCGAGCGCGACGAGCGCGCCACCAGCCTCGTC
GACATGCCGCCCGACAGCTCCTGGCGCCTCCCGGGCATCGTCCTGTGGCTGCTGCTGCTCGCCCAGATCGTCCTG
TACCCGCTGCTGGCCGCCGTCGTCGAGCGCTGGGTGCACGGCGCCGCCGCCGAGGGCCGCCACGTGCTCGTCGCC
GGCGAGGGGGGCGCCGGCCTCGGCGACAACGCCGTCCGGCTCGACCGCCTGACCAAGGTCTACCACCCGGGCCCG
CTGTCCCGCCTCGGCGCCGCCCTGCTCTCCTTCTTCCTCGGGCGCCGGCCGCGGGAGCCGGTCGTGGCGGTGCGC
GAGCTGAGCCTGGACGTGCCGCGCGGCCAGATCGTCACGCTGCTGGGCGCCAACGGCAGCGGCAAGAGCACGACG
CTCGACGCCATCGCCGGCCTGCACCGGCTGTCGAGCGGCTCCGTCGCCGTCGACGGCACCGGCGGCCTGGGCGTC
GCGCCGCAGAAGAACGTGCTGTGGGACGACCTGACGGTGCTCGAGCACCTGGTCCGCGACGCCCTCGCCCGCACC
CTGTCGGGCGGCCAGAAGCGCAAGCTGCAGCTGGGCATGATGCTGACGGGCGGCAGCGCCGTCTGCTGCGTCGAC
GAGGTCAGCAGCGGCCTCGACCCGCTGTCGCGCCGCAAGATCTGGGACATCCTGCTGGCCGAGCGCGGCCGCCGC
ACCCTGATCCTGACGACGCACTTCCTCGACGAGGCCGACCTGCTGGCCGACCACATCGCCATCCTCTCCAAGGGC
ACCCTCCGCGCCGCCGGCTCCTCCGTCGAGCTCAAGGACCGCCTGGGCGGCGGCTACAAGGTCCACGTCCACCGG
GCGCCCGGCAGTGACGCCGCCGCCGCCGCCGCCCCGGACCGCACCCCCGACATCGAGGGCGTGCACAAGAGGCGC
GATTTCGACGGCGGCGTCACCTACGTCTCGCCCACGTCCCGCCTGGCGGCCCAGGTCATCGGCCGGCTCGACGGC
TGCGGCATCACCGACTACCGCTTCTCCGGCCCGACCATCGAGGACGTCTTCCTGCGGCTGGCGGAGGAGATCCAG
GACGAGCAGCAGGTGGGCGGAGGCGACGGCGACGGCGACGGCGACGGCGACGGCGACAGCCCCAAGGGCGTCGCC
GAGAAGAAGGTCGTCGTCGTCCAGCAGCAGCAGCCGGACCTGGGCCTCATGGACGGCACGCACGTCGGCGCAGCT
GGACGCTGTACCTGCTGGCCTTCTGCCTGCCCGTGTTCGCGGCGGCGCTGA
Gene >Hirsu2|5503
ATGCGCGCCGGCGTCTTCGCCAACACGGCCGCCGCCGTCGTCGTCCTGCACTCGCTGCTGGCCGGCCTCGCCCTC
GCCTCCTTCGCCCTGCTGTGCGCCGCGCCCTTCCGCCGCGCCCAGCTGAGCGGCATCACCGCCACCCTGGCCGCC
CTGCTGCTGGCCATCCTGGCCCAGTCCATCACGGGGCCCGGCACCGCCGCCGTCGCCGTCCTGTCCGCCCTCTTC
GCCCCCTGCAACTACGTCTACTTCGTCACCCTCATGGCCCACTTCGAGCGCGACGAGCGCGCCACCAGCCTCGTC
GACATGCCGCCCGACAGCTCCTGGCGCCTCCCGGGCATCGTCCTGTGGCTGCTGCTGCTCGCCCAGATCGTCCTG
TACCCGCTGCTGGCCGCCGTCGTCGAGCGCTGGGTGCACGGCGCCGCCGCCGAGGGCCGCCACGTGCTCGTCGCC
GGCGAGGGGGGCGCCGGCCTCGGCGACAACGCCGTCCGGCTCGACCGCCTGACCAAGGTCTACCACCCGGGCCCG
CTGTCCCGCCTCGGCGCCGCCCTGCTCTCCTTCTTCCTCGGGCGCCGGCCGCGGGAGCCGGTCGTGGCGGTGCGC
GAGCTGAGCCTGGACGTGCCGCGCGGCCAGATCGTCACGCTGCTGGGCGCCAACGGCAGCGGCAAGAGCACGACG
CTCGACGCCATCGCCGGCCTGCACCGGCTGTCGAGCGGCTCCGTCGCCGTCGACGGCACCGGCGGCCTGGGCGTC
GCGCCGCAGAAGAACGTGCTGTGGGACGACCTGACGGTGCTCGAGCACCTGGTCGTCTTCAACCGGCTCAAGGCG
CCCGAGCGGCCGGCCGGCCCGGCCGAGATGCTCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNCAAGCGCGACGCCCTCGCCCGCACCCTGTCGGGCGGCCAGAAGCGCAAGCTGCAGCTGGGCATGATGC
TGACGGGCGGCAGCGCCGTCTGCTGCGTCGACGAGGTCAGCAGCGGCCTCGACCCGCTGTCGCGCCGCAAGATCT
GGGACATCCTGCTGGCCGAGCGCGGCCGCCGCACCCTGATCCTGACGACGCACTTCCTCGACGAGGCCGACCTGC
TGGCCGACCACATCGCCATCCTCTCCAAGGGCACCCTCCGCGCCGCCGGCTCCTCCGTCGAGCTCAAGGACCGCC
TGGGCGGCGGCTACAAGGTCCACGTCCACCGGGCGCCCGGCAGTGACGCCGCCGCCGCCGCCGCCCCGGACCGCA
CCCCCGACATCGAGGGCGTGCACAAGAGGCGCGATTTCGACGGCGGCGTCACCTACGTCTCGCCCACGTCCCGCC
TGGCGGCCCAGGTCATCGGCCGGCTCGACGGCTGCGGCATCACCGACTACCGCTTCTCCGGCCCGACCATCGAGG
ACGTCTTCCTGCGGCTGGCGGAGGAGATCCAGGACGAGCAGCAGGTGGGCGGAGGCGACGGCGACGGCGACGGCG
ACGGCGACGGCGACAGCCCCAAGGGCGTCGCCGAGAAGAAGGTCGTCGTCGTCGTCGACGACGACGACGGCGGCG
GCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNAGCAGCAGCAGCAGCAGCCGGACCTGGGCCTCATGGACGGCACGCAC
GTCGGGTACCGGCGGCAGGCGCTGATCCTGCTGCGCAAGCGGGTGACGGTGCTCAAGCGCAGCTGGACGCTGTAC
CTGCTGGCCTTCTGCCTGCCCGTGTTCGCGGCGGCGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail