Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5493
Gene name
LocationContig_275:17435..18691
Strand+
Gene length (bp)1256
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06775 Seipin Putative adipose-regulatory protein (Seipin) 7.6E-58 32 246

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14119|BSCLH_SCHPO Seipin homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A11.04 PE=3 SV=4 25 248 7.0E-09
sp|Q9V3X4|BSCL2_DROME Seipin OS=Drosophila melanogaster GN=Seipin PE=2 SV=1 16 261 8.0E-09

GO

GO Term Description Terminal node
GO:0019915 lipid storage Yes
GO:0051235 maintenance of location No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0051179 localization No
GO:0065008 regulation of biological quality No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 242 264 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5493
MDALEETVRVATSKPVQRAAVNTALLVSGAATLFCLAAIATGLFFQNFVPDHLVKIPVHLQYGSGPNPYGVSSLK
SPPMIKSQQAYDISVVLSIPRSPANVARGNFMVSLHLLGAEASAKLEADARAFSHMHDSFGSHPVIFSSRRSALV
PYIDPMVSVAKRLILLLFHIIIPSSQTCTLKIDLAERLAFPKDSLLPASAYIEVEAGQEIQIYSAALTMTAQLSG
LRWLMFYYRLPTYLAFTFVFWLCELLFMSLAWAAWAAVVTTDSAPSRKGRDAFDDKHIDDDKNQDDSSDYPHNFP
TYGRQRPLKHEPGVKEEDNEEGKEYIYDIPVAGAEADDEDEPDVDEGSSGRRRHDSGLGTSYSEKGSGSMRRRTS
RDTPE*
Coding >Hirsu2|5493
ATGGACGCCCTCGAGGAGACTGTTCGTGTCGCGACGTCGAAGCCTGTGCAGAGGGCGGCCGTCAATACGGCGCTT
CTGGTGTCCGGCGCAGCAACACTCTTCTGCCTGGCTGCTATTGCAACGGGTCTATTCTTCCAGAACTTCGTCCCG
GATCACCTCGTCAAGATACCCGTACACCTTCAATATGGATCGGGTCCCAACCCGTACGGAGTGTCGTCCCTAAAG
AGCCCCCCCATGATCAAGTCTCAGCAAGCATACGATATTTCCGTCGTTCTCTCGATCCCACGGTCCCCGGCCAAT
GTTGCGCGTGGAAATTTCATGGTCTCCTTGCACCTGCTCGGGGCCGAGGCCAGCGCGAAGCTCGAGGCTGACGCG
CGCGCTTTCTCTCACATGCACGATAGTTTCGGAAGTCATCCAGTCATCTTCAGCTCACGTCGCTCGGCGCTTGTG
CCTTATATCGACCCAATGGTGTCCGTGGCCAAGCGACTGATCTTGTTGTTATTTCACATCATCATCCCCAGTTCC
CAGACCTGCACCTTGAAGATTGACTTGGCCGAGCGCCTGGCCTTCCCCAAGGACTCTCTGCTTCCTGCCTCGGCG
TACATCGAAGTGGAGGCCGGGCAGGAAATACAGATCTATAGTGCGGCTCTGACCATGACCGCACAACTGAGCGGG
CTGCGGTGGCTCATGTTCTACTATCGGCTGCCCACGTACCTTGCTTTTACCTTTGTGTTCTGGCTCTGCGAATTA
CTGTTCATGAGCCTTGCCTGGGCCGCCTGGGCTGCCGTTGTGACCACAGACAGTGCTCCTAGCAGGAAAGGCCGC
GATGCCTTCGACGACAAACATATCGATGACGACAAAAATCAGGACGACTCCTCGGACTATCCCCACAACTTCCCT
ACGTATGGGAGGCAGCGGCCGCTCAAGCACGAGCCAGGGGTCAAGGAGGAAGACAATGAGGAAGGGAAGGAGTAC
ATCTATGATATCCCCGTCGCCGGAGCTGAAGCAGATGACGAAGATGAGCCGGATGTGGATGAGGGTAGCAGTGGC
AGGCGGAGACATGATTCTGGTCTGGGTACGAGCTACAGCGAGAAAGGAAGCGGTAGTATGCGCAGAAGGACATCT
CGCGATACGCCCGAGTAG
Transcript >Hirsu2|5493
ATGGACGCCCTCGAGGAGACTGTTCGTGTCGCGACGTCGAAGCCTGTGCAGAGGGCGGCCGTCAATACGGCGCTT
CTGGTGTCCGGCGCAGCAACACTCTTCTGCCTGGCTGCTATTGCAACGGGTCTATTCTTCCAGAACTTCGTCCCG
GATCACCTCGTCAAGATACCCGTACACCTTCAATATGGATCGGGTCCCAACCCGTACGGAGTGTCGTCCCTAAAG
AGCCCCCCCATGATCAAGTCTCAGCAAGCATACGATATTTCCGTCGTTCTCTCGATCCCACGGTCCCCGGCCAAT
GTTGCGCGTGGAAATTTCATGGTCTCCTTGCACCTGCTCGGGGCCGAGGCCAGCGCGAAGCTCGAGGCTGACGCG
CGCGCTTTCTCTCACATGCACGATAGTTTCGGAAGTCATCCAGTCATCTTCAGCTCACGTCGCTCGGCGCTTGTG
CCTTATATCGACCCAATGGTGTCCGTGGCCAAGCGACTGATCTTGTTGTTATTTCACATCATCATCCCCAGTTCC
CAGACCTGCACCTTGAAGATTGACTTGGCCGAGCGCCTGGCCTTCCCCAAGGACTCTCTGCTTCCTGCCTCGGCG
TACATCGAAGTGGAGGCCGGGCAGGAAATACAGATCTATAGTGCGGCTCTGACCATGACCGCACAACTGAGCGGG
CTGCGGTGGCTCATGTTCTACTATCGGCTGCCCACGTACCTTGCTTTTACCTTTGTGTTCTGGCTCTGCGAATTA
CTGTTCATGAGCCTTGCCTGGGCCGCCTGGGCTGCCGTTGTGACCACAGACAGTGCTCCTAGCAGGAAAGGCCGC
GATGCCTTCGACGACAAACATATCGATGACGACAAAAATCAGGACGACTCCTCGGACTATCCCCACAACTTCCCT
ACGTATGGGAGGCAGCGGCCGCTCAAGCACGAGCCAGGGGTCAAGGAGGAAGACAATGAGGAAGGGAAGGAGTAC
ATCTATGATATCCCCGTCGCCGGAGCTGAAGCAGATGACGAAGATGAGCCGGATGTGGATGAGGGTAGCAGTGGC
AGGCGGAGACATGATTCTGGTCTGGGTACGAGCTACAGCGAGAAAGGAAGCGGTAGTATGCGCAGAAGGACATCT
CGCGATACGCCCGAGTAG
Gene >Hirsu2|5493
ATGGTGAGGCTCCTTGTTGCCGGCCACACACGACTGTTTCTGATACTTGCCGTCGGCAGGACGCCCTCGAGGAGA
CTGTTCGTGTCGCGACGTCGAAGCCTGTGCAGAGGGCGGCCGTCAATACGGCGCTTCTGGTGTCCGGCGCAGCAA
CACTCTTCTGCCTGGCTGCTATTGCAACGGGTCTATTCTTCCAGAACTTCGTCCCGGATCACCTCGTCAAGATAC
CCGTACACCTTCAATATGGGTACGCCGACGTCGACCACTTTCCTCTACCGCACGCTGCTGACATGCCATCACTCA
GATCGGGTCCCAACCCGTACGGAGTGTCGTCCCTAAAGAGCCCCCCCATGATCAAGTCTCAGCAAGCATACGATA
TTTCCGTCGTTCTCTCGATCCCACGGTCCCCGGCCAATGTTGCGCGTGGAAATTTCATGGTCTCCTTGCACCTGC
TCGGGGCCGAGGCCAGCGCGAAGCTCGAGGCTGACGCGCGCGCTTTCTCTCACATGCACGATAGTTTCGGAAGTC
ATCCAGTCATCTTCAGCTCACGTCGCTCGGCGCTTGTGCCTTATATCGACCCAATGGTGTCCGTGGCCAAGCGAC
TGATCTTGTTGTTATTTCACATCATCATCCCCAGTTCCCAGACCTGCACCTTGAAGATTGACTTGGCCGAGCGCC
TGGCCTTCCCCAAGGACTCTCTGCTTCCTGCCTCGGCGTACATCGAAGTGGAGGCCGGGCAGGAAATACAGATCT
ATAGTGCGGCTCTGACCATGACCGCACAACTGAGCGGGCTGCGGTGGCTCATGTTCTACTATCGGCTGCCCACGT
ACCTTGCTTTTACCTTTGTGTTCTGGCTCTGCGAATTACTGTTCATGAGCCTTGCCTGGGCCGCCTGGGCTGCCG
TTGTGACCACAGACAGTGCTCCTAGCAGGAAAGGCCGCGATGCCTTCGACGACAAACATATCGATGACGACAAAA
ATCAGGACGACTCCTCGGACTATCCCCACAACTTCCCTACGTATGGGAGGCAGCGGCCGCTCAAGCACGAGCCAG
GGGTCAAGGAGGAAGACAATGAGGAAGGGAAGGAGTACATCTATGATATCCCCGTCGCCGGAGCTGAAGCAGATG
ACGAAGATGAGCCGGATGTGGATGAGGGTAGCAGTGGCAGGCGGAGACATGATTCTGGTCTGGGTACGAGCTACA
GCGAGAAAGGAAGCGGTAGTATGCGCAGAAGGACATCTCGCGATACGCCCGAGTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail