Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5488
Gene name
LocationContig_275:3772..4603
Strand+
Gene length (bp)831
Transcript length (bp)831
Coding sequence length (bp)831
Protein length (aa) 277

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P17549|CP53_ASPNG Benzoate 4-monooxygenase OS=Aspergillus niger GN=bphA PE=1 SV=1 42 137 9.0E-08
sp|Q12645|PID9_FUSSO Pisatin demethylase OS=Fusarium solani subsp. pisi GN=PDAT9 PE=3 SV=1 11 155 3.0E-06
sp|Q4WAW5|FTMC_ASPFU Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 7 91 7.0E-06
sp|B9WZX1|FTMC_ASPFM Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 7 91 7.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5488
MLSGIVASLAVAAAAYGLYAFLLHPALLSPLARIPSAHWSCAVSGLWILAARRRGRENRSLGDAHRRLGRVVRVA
PNALSVDGVDAVRAVYQAGFDKWPWYSVFDNYGLPCLFSTLGAGPHARRKRALSHVYSKSYVQASAAAAAQARAV
LLGRLLPLLRREAAAADPGGTEVQAVLMATTMDLVSAYVFGLAGGTAFLLDEPYRRRWLRLYLCRHRNHFWSQEL
PGLAALCARLGLRLEPPAVDAANEELRAWNKRLCDRAAAAPPPAAPPAAPR*
Coding >Hirsu2|5488
ATGCTGTCCGGCATCGTCGCCTCGCTGGCCGTCGCGGCCGCGGCCTACGGGCTGTACGCCTTCCTCCTGCACCCG
GCGCTGCTGTCGCCGCTGGCGCGCATCCCGAGCGCGCACTGGTCCTGCGCCGTGTCCGGCCTCTGGATCCTGGCC
GCCCGGCGGCGCGGGCGGGAGAACCGGAGCCTCGGCGACGCGCACCGGCGCCTGGGCCGGGTCGTGCGGGTGGCG
CCCAACGCGCTCAGCGTCGACGGCGTCGACGCCGTCCGCGCCGTCTACCAGGCCGGCTTCGACAAGTGGCCGTGG
TACTCCGTCTTCGACAACTACGGCCTGCCCTGCCTCTTCTCGACCCTCGGCGCCGGGCCGCACGCGCGCCGCAAG
CGCGCCCTGTCCCACGTCTACTCCAAGTCGTACGTCCAGGCCTCGGCCGCGGCCGCCGCCCAGGCCCGCGCCGTC
CTGCTCGGCCGCCTGCTGCCGCTGCTGCGCCGCGAGGCCGCCGCCGCCGACCCGGGCGGCACCGAGGTCCAGGCC
GTCCTCATGGCCACCACCATGGACCTCGTCTCGGCCTACGTCTTCGGCCTCGCCGGCGGCACCGCCTTCCTGCTG
GACGAGCCGTACCGCCGCCGCTGGCTGCGCCTGTACCTGTGCCGCCACCGGAACCACTTCTGGAGCCAGGAGCTG
CCGGGCCTGGCCGCGCTGTGCGCCCGGCTCGGCCTCCGGCTCGAGCCGCCCGCCGTCGACGCCGCCAACGAGGAG
CTGAGGGCGTGGAATAAGCGGCTGTGCGACCGGGCCGCCGCCGCGCCGCCGCCCGCCGCGCCGCCCGCCGCGCCT
CGATAG
Transcript >Hirsu2|5488
ATGCTGTCCGGCATCGTCGCCTCGCTGGCCGTCGCGGCCGCGGCCTACGGGCTGTACGCCTTCCTCCTGCACCCG
GCGCTGCTGTCGCCGCTGGCGCGCATCCCGAGCGCGCACTGGTCCTGCGCCGTGTCCGGCCTCTGGATCCTGGCC
GCCCGGCGGCGCGGGCGGGAGAACCGGAGCCTCGGCGACGCGCACCGGCGCCTGGGCCGGGTCGTGCGGGTGGCG
CCCAACGCGCTCAGCGTCGACGGCGTCGACGCCGTCCGCGCCGTCTACCAGGCCGGCTTCGACAAGTGGCCGTGG
TACTCCGTCTTCGACAACTACGGCCTGCCCTGCCTCTTCTCGACCCTCGGCGCCGGGCCGCACGCGCGCCGCAAG
CGCGCCCTGTCCCACGTCTACTCCAAGTCGTACGTCCAGGCCTCGGCCGCGGCCGCCGCCCAGGCCCGCGCCGTC
CTGCTCGGCCGCCTGCTGCCGCTGCTGCGCCGCGAGGCCGCCGCCGCCGACCCGGGCGGCACCGAGGTCCAGGCC
GTCCTCATGGCCACCACCATGGACCTCGTCTCGGCCTACGTCTTCGGCCTCGCCGGCGGCACCGCCTTCCTGCTG
GACGAGCCGTACCGCCGCCGCTGGCTGCGCCTGTACCTGTGCCGCCACCGGAACCACTTCTGGAGCCAGGAGCTG
CCGGGCCTGGCCGCGCTGTGCGCCCGGCTCGGCCTCCGGCTCGAGCCGCCCGCCGTCGACGCCGCCAACGAGGAG
CTGAGGGCGTGGAATAAGCGGCTGTGCGACCGGGCCGCCGCCGCGCCGCCGCCCGCCGCGCCGCCCGCCGCGCCT
CGATAG
Gene >Hirsu2|5488
ATGCTGTCCGGCATCGTCGCCTCGCTGGCCGTCGCGGCCGCGGCCTACGGGCTGTACGCCTTCCTCCTGCACCCG
GCGCTGCTGTCGCCGCTGGCGCGCATCCCGAGCGCGCACTGGTCCTGCGCCGTGTCCGGCCTCTGGATCCTGGCC
GCCCGGCGGCGCGGGCGGGAGAACCGGAGCCTCGGCGACGCGCACCGGCGCCTGGGCCGGGTCGTGCGGGTGGCG
CCCAACGCGCTCAGCGTCGACGGCGTCGACGCCGTCCGCGCCGTCTACCAGGCCGGCTTCGACAAGTGGCCGTGG
TACTCCGTCTTCGACAACTACGGCCTGCCCTGCCTCTTCTCGACCCTCGGCGCCGGGCCGCACGCGCGCCGCAAG
CGCGCCCTGTCCCACGTCTACTCCAAGTCGTACGTCCAGGCCTCGGCCGCGGCCGCCGCCCAGGCCCGCGCCGTC
CTGCTCGGCCGCCTGCTGCCGCTGCTGCGCCGCGAGGCCGCCGCCGCCGACCCGGGCGGCACCGAGGTCCAGGCC
GTCCTCATGGCCACCACCATGGACCTCGTCTCGGCCTACGTCTTCGGCCTCGCCGGCGGCACCGCCTTCCTGCTG
GACGAGCCGTACCGCCGCCGCTGGCTGCGCCTGTACCTGTGCCGCCACCGGAACCACTTCTGGAGCCAGGAGCTG
CCGGGCCTGGCCGCGCTGTGCGCCCGGCTCGGCCTCCGGCTCGAGCCGCCCGCCGTCGACGCCGCCAACGAGGAG
CTGAGGGCGTGGAATAAGCGGCTGTGCGACCGGGCCGCCGCCGCGCCGCCGCCCGCCGCGCCGCCCGCCGCGCCT
CGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail