Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5486
Gene name
LocationContig_2749:499..1762
Strand+
Gene length (bp)1263
Transcript length (bp)1206
Coding sequence length (bp)1206
Protein length (aa) 402

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 2.3E-11 108 304

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14329|ZRG17_SCHPO Probable zinc transporter zrg17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zrg17 PE=1 SV=1 39 396 9.0E-37
sp|P53735|ZRG17_YEAST Protein ZRG17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRG17 PE=1 SV=1 5 201 2.0E-18
sp|Q6ICY4|MTPC2_ARATH Metal tolerance protein C2 OS=Arabidopsis thaliana GN=MTPC2 PE=2 SV=1 150 362 5.0E-06

GO

GO Term Description Terminal node
GO:0008324 cation transmembrane transporter activity Yes
GO:0006812 cation transport Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006811 ion transport No
GO:0015075 ion transmembrane transporter activity No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0022857 transmembrane transporter activity No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 89 106 17
2 116 138 22
3 159 181 22
4 201 223 22
5 243 265 22
6 275 297 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5486
MSTYDEAGDTASPATESNPFNFKTQVISASPIKSNIGQRRGHKYKHSSISTQHQIFQEPPHRPPPVLPASLPIPT
IPEAWKSMHRDQRTRLYWSLCHLALAVYIFFRSHASLAAKALSHLVFFDAGSAAVSVAVDVLGNFEVWRRSSIRH
PFGLERAEVLVGFAFSIFLLFGGFDLISHNLKHMLEFMGDHEAHHEHAHDHISRGSVDLIAASAIASTLISAYGL
KNHFRIAKVMRVSCLAALPSILSNPFHFLTLLFSALIATLPSFSNPLQAWLDRVICAVISLAMFGLGVRLAVAQG
LMLLMSYGGSNGNPSVSSVLHEIESEPDISGVEDAQFWQVNYGLCIANIKVSVAKGYEESALSRLRNRISSLIQN
RLGEGYGTGGTIRWEVTLQINADVVT*
Coding >Hirsu2|5486
ATGTCCACTTATGACGAGGCTGGGGACACGGCCTCGCCTGCCACTGAGTCGAACCCCTTCAACTTCAAGACCCAG
GTCATCTCAGCTTCCCCAATCAAATCTAACATTGGCCAGCGCCGTGGTCATAAATACAAACACAGCAGCATCTCG
ACACAGCACCAAATCTTTCAGGAGCCACCCCACAGGCCGCCCCCGGTTCTTCCCGCGTCGCTGCCCATACCTACG
ATACCTGAGGCTTGGAAGAGCATGCACAGAGACCAGCGAACCAGGCTTTATTGGAGCCTATGCCATCTCGCTCTC
GCTGTCTATATCTTCTTCCGATCCCACGCCTCCCTCGCGGCAAAGGCTCTCTCACATCTTGTCTTTTTCGATGCC
GGGAGTGCGGCTGTCTCTGTTGCTGTCGATGTACTCGGAAACTTTGAAGTATGGCGACGAAGCAGCATCAGACAC
CCCTTCGGTCTCGAGAGGGCAGAAGTTCTCGTTGGCTTTGCTTTTTCCATCTTCCTTCTTTTTGGCGGCTTCGAC
CTCATCTCACACAATCTCAAACACATGCTTGAATTCATGGGCGACCACGAGGCTCATCATGAGCATGCCCATGAT
CACATTTCGCGGGGATCTGTCGACTTGATCGCCGCTAGTGCCATAGCGAGCACTCTGATCTCGGCCTATGGCCTC
AAGAATCATTTCCGCATTGCAAAAGTGATGAGGGTTTCCTGCCTAGCGGCTTTGCCCAGCATCCTGTCCAACCCC
TTTCACTTTTTGACCCTACTCTTTTCAGCGTTAATAGCTACGCTACCCTCTTTCTCCAACCCGCTCCAGGCGTGG
CTGGACCGAGTCATATGCGCCGTCATTTCCCTTGCCATGTTTGGTCTCGGGGTACGTCTCGCTGTCGCTCAAGGG
CTAATGCTACTTATGTCATATGGAGGCAGTAACGGAAACCCAAGTGTCTCTTCAGTCTTGCATGAAATCGAATCA
GAACCGGATATTTCGGGCGTCGAAGATGCCCAGTTCTGGCAAGTCAATTATGGGCTCTGTATAGCCAATATTAAG
GTCAGCGTTGCCAAGGGATATGAAGAGTCGGCGTTGAGTAGATTGCGCAACCGCATATCCTCGCTGATACAGAAT
CGACTTGGCGAAGGCTACGGCACAGGAGGCACCATCCGGTGGGAAGTGACCTTGCAAATAAATGCGGATGTTGTC
ACTTAA
Transcript >Hirsu2|5486
ATGTCCACTTATGACGAGGCTGGGGACACGGCCTCGCCTGCCACTGAGTCGAACCCCTTCAACTTCAAGACCCAG
GTCATCTCAGCTTCCCCAATCAAATCTAACATTGGCCAGCGCCGTGGTCATAAATACAAACACAGCAGCATCTCG
ACACAGCACCAAATCTTTCAGGAGCCACCCCACAGGCCGCCCCCGGTTCTTCCCGCGTCGCTGCCCATACCTACG
ATACCTGAGGCTTGGAAGAGCATGCACAGAGACCAGCGAACCAGGCTTTATTGGAGCCTATGCCATCTCGCTCTC
GCTGTCTATATCTTCTTCCGATCCCACGCCTCCCTCGCGGCAAAGGCTCTCTCACATCTTGTCTTTTTCGATGCC
GGGAGTGCGGCTGTCTCTGTTGCTGTCGATGTACTCGGAAACTTTGAAGTATGGCGACGAAGCAGCATCAGACAC
CCCTTCGGTCTCGAGAGGGCAGAAGTTCTCGTTGGCTTTGCTTTTTCCATCTTCCTTCTTTTTGGCGGCTTCGAC
CTCATCTCACACAATCTCAAACACATGCTTGAATTCATGGGCGACCACGAGGCTCATCATGAGCATGCCCATGAT
CACATTTCGCGGGGATCTGTCGACTTGATCGCCGCTAGTGCCATAGCGAGCACTCTGATCTCGGCCTATGGCCTC
AAGAATCATTTCCGCATTGCAAAAGTGATGAGGGTTTCCTGCCTAGCGGCTTTGCCCAGCATCCTGTCCAACCCC
TTTCACTTTTTGACCCTACTCTTTTCAGCGTTAATAGCTACGCTACCCTCTTTCTCCAACCCGCTCCAGGCGTGG
CTGGACCGAGTCATATGCGCCGTCATTTCCCTTGCCATGTTTGGTCTCGGGGTACGTCTCGCTGTCGCTCAAGGG
CTAATGCTACTTATGTCATATGGAGGCAGTAACGGAAACCCAAGTGTCTCTTCAGTCTTGCATGAAATCGAATCA
GAACCGGATATTTCGGGCGTCGAAGATGCCCAGTTCTGGCAAGTCAATTATGGGCTCTGTATAGCCAATATTAAG
GTCAGCGTTGCCAAGGGATATGAAGAGTCGGCGTTGAGTAGATTGCGCAACCGCATATCCTCGCTGATACAGAAT
CGACTTGGCGAAGGCTACGGCACAGGAGGCACCATCCGGTGGGAAGTGACCTTGCAAATAAATGCGGATGTTGTC
ACTTAA
Gene >Hirsu2|5486
ATGTCCACTTATGACGAGGCTGGGGACACGGCCTCGCCTGCCACTGAGTCGAACCCCTTCAACTTCAAGACCCAG
GTCATCTCAGCTTCCCCAATCAAATCTGTACGACCCTGTTGCTGCCAAGGAAAATATATCTCACTTCAGCTAACC
TCGCGACAGAACATTGGCCAGCGCCGTGGTCATAAATACAAACACAGCAGCATCTCGACACAGCACCAAATCTTT
CAGGAGCCACCCCACAGGCCGCCCCCGGTTCTTCCCGCGTCGCTGCCCATACCTACGATACCTGAGGCTTGGAAG
AGCATGCACAGAGACCAGCGAACCAGGCTTTATTGGAGCCTATGCCATCTCGCTCTCGCTGTCTATATCTTCTTC
CGATCCCACGCCTCCCTCGCGGCAAAGGCTCTCTCACATCTTGTCTTTTTCGATGCCGGGAGTGCGGCTGTCTCT
GTTGCTGTCGATGTACTCGGAAACTTTGAAGTATGGCGACGAAGCAGCATCAGACACCCCTTCGGTCTCGAGAGG
GCAGAAGTTCTCGTTGGCTTTGCTTTTTCCATCTTCCTTCTTTTTGGCGGCTTCGACCTCATCTCACACAATCTC
AAACACATGCTTGAATTCATGGGCGACCACGAGGCTCATCATGAGCATGCCCATGATCACATTTCGCGGGGATCT
GTCGACTTGATCGCCGCTAGTGCCATAGCGAGCACTCTGATCTCGGCCTATGGCCTCAAGAATCATTTCCGCATT
GCAAAAGTGATGAGGGTTTCCTGCCTAGCGGCTTTGCCCAGCATCCTGTCCAACCCCTTTCACTTTTTGACCCTA
CTCTTTTCAGCGTTAATAGCTACGCTACCCTCTTTCTCCAACCCGCTCCAGGCGTGGCTGGACCGAGTCATATGC
GCCGTCATTTCCCTTGCCATGTTTGGTCTCGGGGTACGTCTCGCTGTCGCTCAAGGGCTAATGCTACTTATGTCA
TATGGAGGCAGTAACGGAAACCCAAGTGTCTCTTCAGTCTTGCATGAAATCGAATCAGAACCGGATATTTCGGGC
GTCGAAGATGCCCAGTTCTGGCAAGTCAATTATGGGCTCTGTATAGCCAATATTAAGGTCAGCGTTGCCAAGGGA
TATGAAGAGTCGGCGTTGAGTAGATTGCGCAACCGCATATCCTCGCTGATACAGAATCGACTTGGCGAAGGCTAC
GGCACAGGAGGCACCATCCGGTGGGAAGTGACCTTGCAAATAAATGCGGATGTTGTCACTTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail