Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5485
Gene name
LocationContig_2747:1160..1940
Strand-
Gene length (bp)780
Transcript length (bp)780
Coding sequence length (bp)780
Protein length (aa) 260

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09358 E1_UFD Ubiquitin fold domain 2.4E-30 164 254
PF10585 UBA_e1_thiolCys Ubiquitin-activating enzyme active site 4.9E-24 19 88
PF00899 ThiF ThiF family 5.2E-12 75 148

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P52495|UBA1_CANAW Ubiquitin-activating enzyme E1 1 OS=Candida albicans (strain WO-1) GN=UBA1 PE=3 SV=2 6 258 1.0E-101
sp|P22515|UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA1 PE=1 SV=2 17 258 5.0E-100
sp|O94609|UBA1_SCHPO Ubiquitin-activating enzyme E1 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr3 PE=1 SV=1 26 258 8.0E-83
sp|Q5U300|UBA1_RAT Ubiquitin-like modifier-activating enzyme 1 OS=Rattus norvegicus GN=Uba1 PE=1 SV=1 19 259 4.0E-79
sp|A3KMV5|UBA1_BOVIN Ubiquitin-like modifier-activating enzyme 1 OS=Bos taurus GN=UBA1 PE=2 SV=1 19 259 4.0E-79
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P52495|UBA1_CANAW Ubiquitin-activating enzyme E1 1 OS=Candida albicans (strain WO-1) GN=UBA1 PE=3 SV=2 6 258 1.0E-101
sp|P22515|UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA1 PE=1 SV=2 17 258 5.0E-100
sp|O94609|UBA1_SCHPO Ubiquitin-activating enzyme E1 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr3 PE=1 SV=1 26 258 8.0E-83
sp|Q5U300|UBA1_RAT Ubiquitin-like modifier-activating enzyme 1 OS=Rattus norvegicus GN=Uba1 PE=1 SV=1 19 259 4.0E-79
sp|A3KMV5|UBA1_BOVIN Ubiquitin-like modifier-activating enzyme 1 OS=Bos taurus GN=UBA1 PE=2 SV=1 19 259 4.0E-79
sp|Q02053|UBA1_MOUSE Ubiquitin-like modifier-activating enzyme 1 OS=Mus musculus GN=Uba1 PE=1 SV=1 19 259 5.0E-79
sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens GN=UBA1 PE=1 SV=3 19 259 7.0E-79
sp|Q29504|UBA1_RABIT Ubiquitin-like modifier-activating enzyme 1 OS=Oryctolagus cuniculus GN=UBA1 PE=1 SV=1 19 259 2.0E-78
sp|P31254|UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus GN=Uba1y PE=1 SV=2 22 259 6.0E-69
sp|Q55C16|UBA1_DICDI Ubiquitin-like modifier-activating enzyme 1 OS=Dictyostelium discoideum GN=uba1 PE=3 SV=1 18 257 1.0E-65
sp|P31252|UBE13_WHEAT Ubiquitin-activating enzyme E1 3 OS=Triticum aestivum GN=UBA3 PE=1 SV=1 20 259 7.0E-54
sp|P93028|UBE11_ARATH Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana GN=UBA1 PE=1 SV=1 23 259 3.0E-52
sp|P20973|UBE11_WHEAT Ubiquitin-activating enzyme E1 1 OS=Triticum aestivum GN=UBA1 PE=1 SV=1 20 259 5.0E-52
sp|P31251|UBE12_WHEAT Ubiquitin-activating enzyme E1 2 OS=Triticum aestivum GN=UBA2 PE=2 SV=1 20 259 5.0E-52
sp|P92974|UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana GN=UBA2 PE=1 SV=1 46 256 6.0E-50
sp|A0AVT1|UBA6_HUMAN Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens GN=UBA6 PE=1 SV=1 29 226 5.0E-35
sp|Q8C7R4|UBA6_MOUSE Ubiquitin-like modifier-activating enzyme 6 OS=Mus musculus GN=Uba6 PE=1 SV=1 42 226 3.0E-34
sp|P41226|UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7 OS=Homo sapiens GN=UBA7 PE=1 SV=2 45 252 4.0E-24
sp|Q54L40|SAE2_DICDI SUMO-activating enzyme subunit 2 OS=Dictyostelium discoideum GN=uba2 PE=3 SV=1 49 199 2.0E-11
sp|Q7SXG4|SAE2_DANRE SUMO-activating enzyme subunit 2 OS=Danio rerio GN=uba2 PE=1 SV=2 52 132 3.0E-11
sp|Q28GH3|SAE2_XENTR SUMO-activating enzyme subunit 2 OS=Xenopus tropicalis GN=uba2 PE=2 SV=1 52 132 1.0E-10
sp|Q9UBT2|SAE2_HUMAN SUMO-activating enzyme subunit 2 OS=Homo sapiens GN=UBA2 PE=1 SV=2 53 132 2.0E-10
sp|Q7ZY60|SAE2B_XENLA SUMO-activating enzyme subunit 2-B OS=Xenopus laevis GN=uba2-b PE=2 SV=2 52 132 4.0E-10
sp|Q642Q1|SAE2A_XENLA SUMO-activating enzyme subunit 2-A OS=Xenopus laevis GN=uba2-a PE=2 SV=1 52 132 4.0E-10
sp|Q9Z1F9|SAE2_MOUSE SUMO-activating enzyme subunit 2 OS=Mus musculus GN=Uba2 PE=1 SV=1 56 132 5.0E-10
sp|O42939|UBA2_SCHPO Ubiquitin-activating enzyme E1-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba2 PE=1 SV=1 51 131 3.0E-09
sp|Q9SJT1|SAE2_ARATH SUMO-activating enzyme subunit 2 OS=Arabidopsis thaliana GN=SAE2 PE=1 SV=1 21 127 1.0E-08
sp|Q9NAN1|SAE2_CAEEL SUMO-activating enzyme subunit uba-2 OS=Caenorhabditis elegans GN=uba-2 PE=3 SV=3 58 119 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0008641 ubiquitin-like modifier activating enzyme activity Yes
GO:0016874 ligase activity No
GO:0003674 molecular_function No
GO:0016877 ligase activity, forming carbon-sulfur bonds No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

Domain # Start End Length
1 89 111 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5485
MACRARLTADGARARQDPNANTSFDDGDKLDKIIAGIPSPKTLSGFQLQPVEFEKDDDTNHHIDFITACSNLRAE
NYKIEAADRHKTKFIAGKIIPAIATTTALVTGLVVLELYKVIDGKDDLEQYKNGFINLALPFFGFSEPIGSPKVE
YQGPSGKVKLDKIWDRFELEDVTLRELLEHFKGQGLSISMLSSGVSLLYASFFPPAKLKERYGMKLSKLVETISK
KAIPPHQKEVIFEMVAEDMAEEDVEVPYIKVRVR*
Coding >Hirsu2|5485
ATGGCTTGCCGTGCAAGGCTGACGGCTGACGGTGCTCGGGCGAGGCAGGACCCCAACGCCAACACGAGCTTCGAC
GACGGCGACAAGCTGGACAAGATCATCGCGGGCATCCCGTCGCCCAAGACGCTGTCGGGGTTCCAGCTGCAGCCG
GTGGAGTTTGAGAAGGACGACGACACGAACCACCACATCGACTTCATCACGGCGTGCAGCAACCTGCGGGCGGAA
AACTACAAGATCGAGGCGGCGGACCGGCACAAGACCAAGTTCATCGCGGGCAAGATCATTCCGGCGATTGCGACG
ACGACGGCGCTGGTGACGGGGCTGGTGGTGCTGGAGCTGTACAAGGTGATTGACGGCAAGGATGACCTGGAGCAG
TACAAGAACGGGTTCATCAACCTGGCGCTGCCGTTCTTCGGCTTCAGCGAGCCGATCGGCAGCCCCAAGGTGGAG
TACCAGGGCCCGTCGGGCAAGGTGAAGCTGGACAAGATCTGGGACCGGTTCGAGCTGGAGGACGTGACGCTGCGG
GAGCTGCTGGAGCACTTCAAGGGGCAGGGGCTGAGCATCAGCATGCTCAGCTCGGGCGTGAGCCTGCTGTACGCC
AGCTTCTTCCCGCCGGCGAAGCTCAAGGAGCGGTACGGGATGAAGCTGAGCAAGCTGGTGGAGACGATTTCGAAG
AAGGCGATTCCGCCGCACCAGAAGGAGGTCATCTTCGAGATGGTGGCGGAGGACATGGCGGAGGAGGACGTCGAG
GTGCCGTACATCAAAGTGAGGGTCCGATGA
Transcript >Hirsu2|5485
ATGGCTTGCCGTGCAAGGCTGACGGCTGACGGTGCTCGGGCGAGGCAGGACCCCAACGCCAACACGAGCTTCGAC
GACGGCGACAAGCTGGACAAGATCATCGCGGGCATCCCGTCGCCCAAGACGCTGTCGGGGTTCCAGCTGCAGCCG
GTGGAGTTTGAGAAGGACGACGACACGAACCACCACATCGACTTCATCACGGCGTGCAGCAACCTGCGGGCGGAA
AACTACAAGATCGAGGCGGCGGACCGGCACAAGACCAAGTTCATCGCGGGCAAGATCATTCCGGCGATTGCGACG
ACGACGGCGCTGGTGACGGGGCTGGTGGTGCTGGAGCTGTACAAGGTGATTGACGGCAAGGATGACCTGGAGCAG
TACAAGAACGGGTTCATCAACCTGGCGCTGCCGTTCTTCGGCTTCAGCGAGCCGATCGGCAGCCCCAAGGTGGAG
TACCAGGGCCCGTCGGGCAAGGTGAAGCTGGACAAGATCTGGGACCGGTTCGAGCTGGAGGACGTGACGCTGCGG
GAGCTGCTGGAGCACTTCAAGGGGCAGGGGCTGAGCATCAGCATGCTCAGCTCGGGCGTGAGCCTGCTGTACGCC
AGCTTCTTCCCGCCGGCGAAGCTCAAGGAGCGGTACGGGATGAAGCTGAGCAAGCTGGTGGAGACGATTTCGAAG
AAGGCGATTCCGCCGCACCAGAAGGAGGTCATCTTCGAGATGGTGGCGGAGGACATGGCGGAGGAGGACGTCGAG
GTGCCGTACATCAAAGTGAGGGTCCGATGA
Gene >Hirsu2|5485
ATGGCTTGCCGTGCAAGGCTGACGGCTGACGGTGCTCGGGCGAGGCAGGACCCCAACGCCAACACGAGCTTCGAC
GACGGCGACAAGCTGGACAAGATCATCGCGGGCATCCCGTCGCCCAAGACGCTGTCGGGGTTCCAGCTGCAGCCG
GTGGAGTTTGAGAAGGACGACGACACGAACCACCACATCGACTTCATCACGGCGTGCAGCAACCTGCGGGCGGAA
AACTACAAGATCGAGGCGGCGGACCGGCACAAGACCAAGTTCATCGCGGGCAAGATCATTCCGGCGATTGCGACG
ACGACGGCGCTGGTGACGGGGCTGGTGGTGCTGGAGCTGTACAAGGTGATTGACGGCAAGGATGACCTGGAGCAG
TACAAGAACGGGTTCATCAACCTGGCGCTGCCGTTCTTCGGCTTCAGCGAGCCGATCGGCAGCCCCAAGGTGGAG
TACCAGGGCCCGTCGGGCAAGGTGAAGCTGGACAAGATCTGGGACCGGTTCGAGCTGGAGGACGTGACGCTGCGG
GAGCTGCTGGAGCACTTCAAGGGGCAGGGGCTGAGCATCAGCATGCTCAGCTCGGGCGTGAGCCTGCTGTACGCC
AGCTTCTTCCCGCCGGCGAAGCTCAAGGAGCGGTACGGGATGAAGCTGAGCAAGCTGGTGGAGACGATTTCGAAG
AAGGCGATTCCGCCGCACCAGAAGGAGGTCATCTTCGAGATGGTGGCGGAGGACATGGCGGAGGAGGACGTCGAG
GTGCCGTACATCAAAGTGAGGGTCCGATGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail