Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5480
Gene name
LocationContig_2742:422..881
Strand-
Gene length (bp)459
Transcript length (bp)459
Coding sequence length (bp)459
Protein length (aa) 153

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0895 0.0973 0.9686 0.052 0.0724 0.0056 0.1209 0.0365 0.0704 0.003

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999583

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup9879
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|5480 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5480
MKSDRTTGLLICLMSAAIAAPASEYSLDKRTVSSTEATANIELNMCTRERDIQIIDEVEIESIAGITERSKHSAK
FVMIGSAEETEQVQEIGEQEETEGLDKTAEMETEHESHVLRRSLRAPGPVTPPDRSRGYPVTGQAPVRGADGIVN
YD*
Coding >Hirsu2|5480
ATGAAGTCGGATCGAACTACTGGCCTCCTAATTTGCCTCATGAGTGCGGCCATTGCCGCTCCCGCTAGCGAATAC
TCGCTCGACAAACGCACCGTGTCATCGACGGAAGCCACCGCGAACATCGAGTTAAACATGTGTACCCGTGAAAGA
GACATCCAAATCATTGACGAGGTCGAAATCGAGTCCATTGCAGGGATCACGGAAAGGTCTAAACACAGCGCCAAG
TTCGTCATGATAGGATCGGCGGAAGAAACGGAGCAGGTGCAGGAAATTGGGGAGCAGGAAGAGACGGAGGGCTTG
GACAAGACAGCCGAGATGGAAACCGAACATGAAAGTCACGTCCTTCGGCGTTCTTTAAGAGCTCCTGGCCCTGTT
ACTCCCCCAGATCGGTCGAGAGGGTACCCGGTCACCGGTCAGGCCCCTGTTAGAGGTGCCGACGGCATAGTCAAC
TATGATTGA
Transcript >Hirsu2|5480
ATGAAGTCGGATCGAACTACTGGCCTCCTAATTTGCCTCATGAGTGCGGCCATTGCCGCTCCCGCTAGCGAATAC
TCGCTCGACAAACGCACCGTGTCATCGACGGAAGCCACCGCGAACATCGAGTTAAACATGTGTACCCGTGAAAGA
GACATCCAAATCATTGACGAGGTCGAAATCGAGTCCATTGCAGGGATCACGGAAAGGTCTAAACACAGCGCCAAG
TTCGTCATGATAGGATCGGCGGAAGAAACGGAGCAGGTGCAGGAAATTGGGGAGCAGGAAGAGACGGAGGGCTTG
GACAAGACAGCCGAGATGGAAACCGAACATGAAAGTCACGTCCTTCGGCGTTCTTTAAGAGCTCCTGGCCCTGTT
ACTCCCCCAGATCGGTCGAGAGGGTACCCGGTCACCGGTCAGGCCCCTGTTAGAGGTGCCGACGGCATAGTCAAC
TATGATTGA
Gene >Hirsu2|5480
ATGAAGTCGGATCGAACTACTGGCCTCCTAATTTGCCTCATGAGTGCGGCCATTGCCGCTCCCGCTAGCGAATAC
TCGCTCGACAAACGCACCGTGTCATCGACGGAAGCCACCGCGAACATCGAGTTAAACATGTGTACCCGTGAAAGA
GACATCCAAATCATTGACGAGGTCGAAATCGAGTCCATTGCAGGGATCACGGAAAGGTCTAAACACAGCGCCAAG
TTCGTCATGATAGGATCGGCGGAAGAAACGGAGCAGGTGCAGGAAATTGGGGAGCAGGAAGAGACGGAGGGCTTG
GACAAGACAGCCGAGATGGAAACCGAACATGAAAGTCACGTCCTTCGGCGTTCTTTAAGAGCTCCTGGCCCTGTT
ACTCCCCCAGATCGGTCGAGAGGGTACCCGGTCACCGGTCAGGCCCCTGTTAGAGGTGCCGACGGCATAGTCAAC
TATGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail