Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5475
Gene name
LocationContig_274:22305..24187
Strand-
Gene length (bp)1882
Transcript length (bp)1764
Coding sequence length (bp)1764
Protein length (aa) 588

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00118 Cpn60_TCP1 TCP-1/cpn60 chaperonin family 1.1E-84 55 556

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60008|HSP60_PARBA Heat shock protein 60, mitochondrial OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP60 PE=1 SV=1 1 565 0.0E+00
sp|P50142|HSP60_AJECA Heat shock protein 60, mitochondrial OS=Ajellomyces capsulatus GN=HSP60 PE=3 SV=2 1 565 0.0E+00
sp|Q5B041|HSP60_EMENI Heat shock protein 60 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp60 PE=1 SV=1 1 570 0.0E+00
sp|O74261|HSP60_CANAL Heat shock protein 60, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSP60 PE=3 SV=1 32 580 0.0E+00
sp|Q09864|HSP60_SCHPO Heat shock protein 60, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp60 PE=1 SV=1 30 564 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60008|HSP60_PARBA Heat shock protein 60, mitochondrial OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=HSP60 PE=1 SV=1 1 565 0.0E+00
sp|P50142|HSP60_AJECA Heat shock protein 60, mitochondrial OS=Ajellomyces capsulatus GN=HSP60 PE=3 SV=2 1 565 0.0E+00
sp|Q5B041|HSP60_EMENI Heat shock protein 60 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hsp60 PE=1 SV=1 1 570 0.0E+00
sp|O74261|HSP60_CANAL Heat shock protein 60, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSP60 PE=3 SV=1 32 580 0.0E+00
sp|Q09864|HSP60_SCHPO Heat shock protein 60, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp60 PE=1 SV=1 30 564 0.0E+00
sp|P19882|HSP60_YEAST Heat shock protein 60, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP60 PE=1 SV=1 14 560 0.0E+00
sp|Q43298|CH62_MAIZE Chaperonin CPN60-2, mitochondrial OS=Zea mays GN=CPN60II PE=2 SV=1 1 577 0.0E+00
sp|Q8L7B5|CH60B_ARATH Chaperonin CPN60-like 1, mitochondrial OS=Arabidopsis thaliana GN=At2g33210 PE=2 SV=1 1 569 0.0E+00
sp|Q05046|CH62_CUCMA Chaperonin CPN60-2, mitochondrial OS=Cucurbita maxima GN=CPN60-2 PE=1 SV=1 5 569 0.0E+00
sp|P29197|CH60A_ARATH Chaperonin CPN60, mitochondrial OS=Arabidopsis thaliana GN=CPN60 PE=1 SV=2 5 566 0.0E+00
sp|Q05045|CH61_CUCMA Chaperonin CPN60-1, mitochondrial OS=Cucurbita maxima GN=CPN60-1 PE=1 SV=1 11 569 0.0E+00
sp|P29185|CH61_MAIZE Chaperonin CPN60-1, mitochondrial OS=Zea mays GN=CPN60I PE=1 SV=2 1 565 0.0E+00
sp|Q3SQS3|CH601_NITWN 60 kDa chaperonin 1 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=groL1 PE=3 SV=1 36 574 0.0E+00
sp|O02649|CH60_DROME 60 kDa heat shock protein, mitochondrial OS=Drosophila melanogaster GN=Hsp60 PE=1 SV=3 31 564 0.0E+00
sp|Q2JYW6|CH604_RHIEC 60 kDa chaperonin 4 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=groL4 PE=3 SV=1 36 577 0.0E+00
sp|Q1M3H2|CH603_RHIL3 60 kDa chaperonin 3 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=groL3 PE=3 SV=1 36 577 0.0E+00
sp|Q2RY28|CH601_RHORT 60 kDa chaperonin 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=groL1 PE=3 SV=1 36 577 0.0E+00
sp|Q2KAU2|CH602_RHIEC 60 kDa chaperonin 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=groL2 PE=3 SV=1 36 565 0.0E+00
sp|P35471|CH605_RHIME 60 kDa chaperonin 5 OS=Rhizobium meliloti (strain 1021) GN=groL5 PE=2 SV=2 36 577 0.0E+00
sp|P50140|CH60_CAEEL Chaperonin homolog Hsp-60, mitochondrial OS=Caenorhabditis elegans GN=hsp-60 PE=2 SV=2 31 566 0.0E+00
sp|A6U901|CH603_SINMW 60 kDa chaperonin 3 OS=Sinorhizobium medicae (strain WSM419) GN=groL3 PE=3 SV=1 36 577 0.0E+00
sp|B0SXR2|CH60_CAUSK 60 kDa chaperonin OS=Caulobacter sp. (strain K31) GN=groL PE=3 SV=1 36 560 0.0E+00
sp|Q9L691|CH602_RHILE 60 kDa chaperonin 2 OS=Rhizobium leguminosarum GN=groL2 PE=3 SV=1 36 564 0.0E+00
sp|A9HK37|CH601_GLUDA 60 kDa chaperonin 1 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=groL1 PE=3 SV=1 36 565 0.0E+00
sp|P77829|CH601_BRADU 60 kDa chaperonin 1 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=groL1 PE=2 SV=3 36 571 0.0E+00
sp|Q2WAW8|CH60_MAGSA 60 kDa chaperonin OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q5FPQ6|CH60_GLUOX 60 kDa chaperonin OS=Gluconobacter oxydans (strain 621H) GN=groL PE=3 SV=1 36 577 0.0E+00
sp|Q2NBL8|CH601_ERYLH 60 kDa chaperonin 1 OS=Erythrobacter litoralis (strain HTCC2594) GN=groL1 PE=3 SV=1 36 569 0.0E+00
sp|Q1GRD4|CH602_SPHAL 60 kDa chaperonin 2 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=groL2 PE=3 SV=1 36 569 0.0E+00
sp|P63039|CH60_RAT 60 kDa heat shock protein, mitochondrial OS=Rattus norvegicus GN=Hspd1 PE=1 SV=1 32 565 0.0E+00
sp|P63038|CH60_MOUSE 60 kDa heat shock protein, mitochondrial OS=Mus musculus GN=Hspd1 PE=1 SV=1 32 565 0.0E+00
sp|Q2IZ16|CH601_RHOP2 60 kDa chaperonin 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=groL1 PE=3 SV=1 33 570 0.0E+00
sp|O33963|CH60_BARHE 60 kDa chaperonin OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q2RWV4|CH602_RHORT 60 kDa chaperonin 2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=groL2 PE=3 SV=1 36 569 0.0E+00
sp|Q11LG4|CH601_CHESB 60 kDa chaperonin 1 OS=Chelativorans sp. (strain BNC1) GN=groL1 PE=3 SV=1 36 566 0.0E+00
sp|Q5ZL72|CH60_CHICK 60 kDa heat shock protein, mitochondrial OS=Gallus gallus GN=HSPD1 PE=1 SV=1 32 565 0.0E+00
sp|P18687|CH60_CRIGR 60 kDa heat shock protein, mitochondrial OS=Cricetulus griseus GN=HSPD1 PE=2 SV=1 32 565 0.0E+00
sp|A4YRI5|CH601_BRASO 60 kDa chaperonin 1 OS=Bradyrhizobium sp. (strain ORS278) GN=groL1 PE=3 SV=1 36 571 0.0E+00
sp|A9IY10|CH60_BART1 60 kDa chaperonin OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q98IH9|CH602_RHILO 60 kDa chaperonin 2 OS=Rhizobium loti (strain MAFF303099) GN=groL2 PE=3 SV=1 36 574 0.0E+00
sp|Q2N5R9|CH602_ERYLH 60 kDa chaperonin 2 OS=Erythrobacter litoralis (strain HTCC2594) GN=groL2 PE=3 SV=1 36 566 0.0E+00
sp|Q0AS40|CH60_MARMM 60 kDa chaperonin OS=Maricaulis maris (strain MCS10) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|P35470|CH602_RHIME 60 kDa chaperonin 2 OS=Rhizobium meliloti (strain 1021) GN=groL2 PE=2 SV=2 36 577 0.0E+00
sp|Q11DQ8|CH602_CHESB 60 kDa chaperonin 2 OS=Chelativorans sp. (strain BNC1) GN=groL2 PE=3 SV=1 36 577 0.0E+00
sp|A5EG60|CH603_BRASB 60 kDa chaperonin 3 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=groL3 PE=3 SV=1 36 571 0.0E+00
sp|A5G1G2|CH60_ACICJ 60 kDa chaperonin OS=Acidiphilium cryptum (strain JF-5) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|A5VBQ6|CH60_SPHWW 60 kDa chaperonin OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q2KAR0|CH603_RHIEC 60 kDa chaperonin 3 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=groL3 PE=3 SV=1 33 581 0.0E+00
sp|B1LVA0|CH60_METRJ 60 kDa chaperonin OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q9L690|CH603_RHILE 60 kDa chaperonin 3 OS=Rhizobium leguminosarum GN=groL3 PE=3 SV=1 33 581 0.0E+00
sp|P10809|CH60_HUMAN 60 kDa heat shock protein, mitochondrial OS=Homo sapiens GN=HSPD1 PE=1 SV=2 32 565 0.0E+00
sp|A8I5R5|CH602_AZOC5 60 kDa chaperonin 2 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=groL2 PE=3 SV=1 36 560 0.0E+00
sp|Q130Z3|CH602_RHOPS 60 kDa chaperonin 2 OS=Rhodopseudomonas palustris (strain BisB5) GN=groL2 PE=3 SV=1 36 570 0.0E+00
sp|P0CAT9|CH60_CAUCR 60 kDa chaperonin OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=groL PE=3 SV=1 36 560 0.0E+00
sp|B8H163|CH60_CAUCN 60 kDa chaperonin OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=groL PE=2 SV=1 36 560 0.0E+00
sp|P35480|CH60_BRANA Chaperonin CPN60, mitochondrial OS=Brassica napus PE=2 SV=1 1 569 0.0E+00
sp|A1UTX7|CH60_BARBK 60 kDa chaperonin OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|A4YS25|CH602_BRASO 60 kDa chaperonin 2 OS=Bradyrhizobium sp. (strain ORS278) GN=groL2 PE=3 SV=1 33 564 0.0E+00
sp|P60364|CH601_RHOPA 60 kDa chaperonin 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=groL1 PE=3 SV=1 36 563 0.0E+00
sp|P35635|CH60_BARBA 60 kDa chaperonin OS=Bartonella bacilliformis GN=groL PE=1 SV=2 36 565 0.0E+00
sp|B1ZAU5|CH60_METPB 60 kDa chaperonin OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|A5EM76|CH604_BRASB 60 kDa chaperonin 4 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=groL4 PE=3 SV=1 33 564 0.0E+00
sp|Q6W163|CH601_RHISN 60 kDa chaperonin 1 OS=Rhizobium sp. (strain NGR234) GN=groL1 PE=3 SV=1 36 577 0.0E+00
sp|Q5NVM5|CH60_PONAB 60 kDa heat shock protein, mitochondrial OS=Pongo abelii GN=HSPD1 PE=2 SV=1 32 565 0.0E+00
sp|Q1MKX4|CH601_RHIL3 60 kDa chaperonin 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=groL1 PE=3 SV=1 33 566 0.0E+00
sp|Q92ZQ4|CH604_RHIME 60 kDa chaperonin 4 OS=Rhizobium meliloti (strain 1021) GN=groL4 PE=3 SV=1 36 564 0.0E+00
sp|P31081|CH60_BOVIN 60 kDa heat shock protein, mitochondrial OS=Bos taurus GN=HSPD1 PE=1 SV=2 32 565 0.0E+00
sp|B2ICU4|CH60_BEII9 60 kDa chaperonin OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|A6U7N0|CH602_SINMW 60 kDa chaperonin 2 OS=Sinorhizobium medicae (strain WSM419) GN=groL2 PE=3 SV=1 36 577 0.0E+00
sp|Q2KBZ7|CH601_RHIEC 60 kDa chaperonin 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=groL1 PE=3 SV=1 36 564 0.0E+00
sp|A5ECI7|CH601_BRASB 60 kDa chaperonin 1 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=groL1 PE=3 SV=1 36 564 0.0E+00
sp|P35469|CH601_RHIME 60 kDa chaperonin 1 OS=Rhizobium meliloti (strain 1021) GN=groL1 PE=2 SV=2 36 564 0.0E+00
sp|Q3SQJ5|CH602_NITWN 60 kDa chaperonin 2 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=groL2 PE=3 SV=1 33 566 0.0E+00
sp|Q8GBD2|CH60_ACEP3 60 kDa chaperonin OS=Acetobacter pasteurianus (strain NBRC 3283 / LMG 1513 / CCTM 1153) GN=groL PE=3 SV=2 36 566 0.0E+00
sp|B5ZRD6|CH60_RHILW 60 kDa chaperonin OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=groL PE=3 SV=1 33 566 0.0E+00
sp|Q1MJF2|CH60_RHIL3 60 kDa chaperonin OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=groL PE=3 SV=1 33 566 0.0E+00
sp|Q98AX9|CH603_RHILO 60 kDa chaperonin 3 OS=Rhizobium loti (strain MAFF303099) GN=groL3 PE=3 SV=1 36 566 0.0E+00
sp|Q4UMF2|CH60_RICFE 60 kDa chaperonin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|A6U6I5|CH601_SINMW 60 kDa chaperonin 1 OS=Sinorhizobium medicae (strain WSM419) GN=groL1 PE=3 SV=1 36 564 0.0E+00
sp|A4Z0U1|CH603_BRASO 60 kDa chaperonin 3 OS=Bradyrhizobium sp. (strain ORS278) GN=groL3 PE=3 SV=1 36 564 0.0E+00
sp|Q2G2Z4|CH60_NOVAD 60 kDa chaperonin OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q6W1D5|CH602_RHISN 60 kDa chaperonin 2 OS=Rhizobium sp. (strain NGR234) GN=groL2 PE=3 SV=1 36 566 0.0E+00
sp|Q07TB7|CH601_RHOP5 60 kDa chaperonin 1 OS=Rhodopseudomonas palustris (strain BisA53) GN=groL1 PE=3 SV=1 36 570 0.0E+00
sp|Q1QK71|CH602_NITHX 60 kDa chaperonin 2 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=groL2 PE=3 SV=1 33 564 0.0E+00
sp|A0L4C9|CH60_MAGMM 60 kDa chaperonin OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|Q89DA6|CH607_BRADU 60 kDa chaperonin 7 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=groL7 PE=3 SV=1 36 564 0.0E+00
sp|A6UM48|CH605_SINMW 60 kDa chaperonin 5 OS=Sinorhizobium medicae (strain WSM419) GN=groL5 PE=3 SV=1 36 564 0.0E+00
sp|P34939|CH60_RHILV 60 kDa chaperonin OS=Rhizobium leguminosarum bv. viciae GN=groL PE=2 SV=1 33 564 0.0E+00
sp|Q93ZM7|CH60C_ARATH Chaperonin CPN60-like 2, mitochondrial OS=Arabidopsis thaliana GN=At3g13860 PE=2 SV=2 33 575 0.0E+00
sp|B6IU98|CH60_RHOCS 60 kDa chaperonin OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q20X88|CH602_RHOPB 60 kDa chaperonin 2 OS=Rhodopseudomonas palustris (strain BisB18) GN=groL2 PE=3 SV=1 36 570 0.0E+00
sp|P30779|CH60_AGRFC 60 kDa chaperonin OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=groL PE=3 SV=2 36 566 0.0E+00
sp|Q9ZCT7|CH60_RICPR 60 kDa chaperonin OS=Rickettsia prowazekii (strain Madrid E) GN=groL PE=3 SV=1 33 571 0.0E+00
sp|O85754|CH60_RICTY 60 kDa chaperonin OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=groL PE=3 SV=2 33 571 0.0E+00
sp|Q3SPG4|CH603_NITWN 60 kDa chaperonin 3 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=groL3 PE=3 SV=1 36 570 0.0E+00
sp|Q89IK8|CH606_BRADU 60 kDa chaperonin 6 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=groL6 PE=3 SV=1 36 564 0.0E+00
sp|B9K1Y8|CH60_AGRVS 60 kDa chaperonin OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q9VMN5|CH60C_DROME 60 kDa heat shock protein homolog 2, mitochondrial OS=Drosophila melanogaster GN=Hsp60C PE=2 SV=2 21 565 0.0E+00
sp|Q0BQ24|CH60_GRABC 60 kDa chaperonin OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=groL PE=3 SV=1 36 577 0.0E+00
sp|A8GPB6|CH60_RICAH 60 kDa chaperonin OS=Rickettsia akari (strain Hartford) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|B8ER20|CH60_METSB 60 kDa chaperonin OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q981J9|CH605_RHILO 60 kDa chaperonin 5 OS=Rhizobium loti (strain MAFF303099) GN=groL5 PE=3 SV=1 36 566 0.0E+00
sp|O33964|CH60_BARQU 60 kDa chaperonin OS=Bartonella quintana (strain Toulouse) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|C3PP72|CH60_RICAE 60 kDa chaperonin OS=Rickettsia africae (strain ESF-5) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|A8GT30|CH60_RICRS 60 kDa chaperonin OS=Rickettsia rickettsii (strain Sheila Smith) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|B0BUM0|CH60_RICRO 60 kDa chaperonin OS=Rickettsia rickettsii (strain Iowa) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|C4K2T9|CH60_RICPU 60 kDa chaperonin OS=Rickettsia peacockii (strain Rustic) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q1RIZ3|CH60_RICBR 60 kDa chaperonin OS=Rickettsia bellii (strain RML369-C) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|A8GW07|CH60_RICB8 60 kDa chaperonin OS=Rickettsia bellii (strain OSU 85-389) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|Q1GVZ9|CH601_SPHAL 60 kDa chaperonin 1 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=groL1 PE=3 SV=1 36 565 0.0E+00
sp|Q92H04|CH60_RICCN 60 kDa chaperonin OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=groL PE=3 SV=1 36 562 0.0E+00
sp|P35862|CH603_BRADU 60 kDa chaperonin 3 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=groL3 PE=1 SV=2 33 580 0.0E+00
sp|A8ILV4|CH601_AZOC5 60 kDa chaperonin 1 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=groL1 PE=3 SV=1 36 564 0.0E+00
sp|A8EY36|CH60_RICCK 60 kDa chaperonin OS=Rickettsia canadensis (strain McKiel) GN=groL PE=3 SV=1 36 562 0.0E+00
sp|A8F2B5|CH60_RICM5 60 kDa chaperonin OS=Rickettsia massiliae (strain Mtu5) GN=groL PE=3 SV=2 36 565 0.0E+00
sp|A7HQQ0|CH60_PARL1 60 kDa chaperonin OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A5EET6|CH602_BRASB 60 kDa chaperonin 2 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=groL2 PE=3 SV=1 33 565 0.0E+00
sp|P48220|CH60_ZYMMO 60 kDa chaperonin OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=groL PE=3 SV=2 36 565 0.0E+00
sp|Q930Y0|CH603_RHIME 60 kDa chaperonin 3 OS=Rhizobium meliloti (strain 1021) GN=groL3 PE=3 SV=1 33 581 0.0E+00
sp|Q607Q3|CH602_METCA 60 kDa chaperonin 2 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=groL2 PE=3 SV=1 36 580 0.0E+00
sp|Q983S4|CH604_RHILO 60 kDa chaperonin 4 OS=Rhizobium loti (strain MAFF303099) GN=groL4 PE=3 SV=1 36 566 0.0E+00
sp|A6UH06|CH604_SINMW 60 kDa chaperonin 4 OS=Sinorhizobium medicae (strain WSM419) GN=groL4 PE=3 SV=1 33 581 0.0E+00
sp|Q4FPA5|CH60_PELUB 60 kDa chaperonin OS=Pelagibacter ubique (strain HTCC1062) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q98IV5|CH601_RHILO 60 kDa chaperonin 1 OS=Rhizobium loti (strain MAFF303099) GN=groL1 PE=3 SV=1 33 562 0.0E+00
sp|Q0B1N7|CH603_BURCM 60 kDa chaperonin 3 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=groL3 PE=3 SV=1 33 570 0.0E+00
sp|Q16C40|CH601_ROSDO 60 kDa chaperonin 1 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=groL1 PE=3 SV=1 33 577 0.0E+00
sp|Q54J97|CH60_DICDI 60 kDa heat shock protein, mitochondrial OS=Dictyostelium discoideum GN=hspA PE=2 SV=1 25 574 0.0E+00
sp|P60365|CH602_RHOPA 60 kDa chaperonin 2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=groL2 PE=3 SV=1 33 564 0.0E+00
sp|C0RKD5|CH60_BRUMB 60 kDa chaperonin OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|P0CB35|CH60_BRUAB 60 kDa chaperonin OS=Brucella abortus biovar 1 (strain 9-941) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q2YIJ3|CH60_BRUA2 60 kDa chaperonin OS=Brucella abortus (strain 2308) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|B2SCZ4|CH60_BRUA1 60 kDa chaperonin OS=Brucella abortus (strain S19) GN=groL PE=2 SV=1 36 564 0.0E+00
sp|Q8YB53|CH60_BRUME 60 kDa chaperonin OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q138M7|CH601_RHOPS 60 kDa chaperonin 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=groL1 PE=3 SV=1 33 564 0.0E+00
sp|Q8FX87|CH60_BRUSU 60 kDa chaperonin OS=Brucella suis biovar 1 (strain 1330) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A9WXQ0|CH60_BRUSI 60 kDa chaperonin OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A9MDV1|CH60_BRUC2 60 kDa chaperonin OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A5VTU1|CH60_BRUO2 60 kDa chaperonin OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q60AY0|CH601_METCA 60 kDa chaperonin 1 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=groL1 PE=3 SV=1 36 566 0.0E+00
sp|A5EX17|CH60_DICNV 60 kDa chaperonin OS=Dichelobacter nodosus (strain VCS1703A) GN=groL PE=3 SV=1 33 567 0.0E+00
sp|A8LJP9|CH60_DINSH 60 kDa chaperonin OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=groL PE=3 SV=1 36 562 0.0E+00
sp|A6H125|CH60_FLAPJ 60 kDa chaperonin OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|A0KCS0|CH603_BURCH 60 kDa chaperonin 3 OS=Burkholderia cenocepacia (strain HI2424) GN=groL3 PE=3 SV=1 33 572 0.0E+00
sp|Q1BV70|CH602_BURCA 60 kDa chaperonin 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=groL2 PE=3 SV=1 33 572 0.0E+00
sp|Q1GJ36|CH60_RUEST 60 kDa chaperonin OS=Ruegeria sp. (strain TM1040) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|Q1QIL6|CH603_NITHX 60 kDa chaperonin 3 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=groL3 PE=3 SV=1 33 565 0.0E+00
sp|Q13ZW7|CH602_BURXL 60 kDa chaperonin 2 OS=Burkholderia xenovorans (strain LB400) GN=groL2 PE=3 SV=1 33 569 0.0E+00
sp|P35861|CH602_BRADU 60 kDa chaperonin 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=groL2 PE=2 SV=2 33 567 0.0E+00
sp|A6X3D0|CH60_OCHA4 60 kDa chaperonin OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q1QP32|CH601_NITHX 60 kDa chaperonin 1 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=groL1 PE=3 SV=1 33 564 0.0E+00
sp|Q9WWL4|CH60_METSS 60 kDa chaperonin OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=groL PE=3 SV=1 36 575 0.0E+00
sp|A4JPD1|CH602_BURVG 60 kDa chaperonin 2 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=groL2 PE=3 SV=1 33 575 0.0E+00
sp|P95678|CH60_RHOCA 60 kDa chaperonin OS=Rhodobacter capsulatus GN=groL PE=1 SV=1 36 566 0.0E+00
sp|Q39ZP5|CH60_GEOMG 60 kDa chaperonin OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|B8GL19|CH60_THISH 60 kDa chaperonin OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=groL PE=3 SV=1 33 569 0.0E+00
sp|A9BXL3|CH60_DELAS 60 kDa chaperonin OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|P20110|CH601_RHOSH 60 kDa chaperonin 1 OS=Rhodobacter sphaeroides GN=groL1 PE=1 SV=4 36 566 0.0E+00
sp|Q3J419|CH601_RHOS4 60 kDa chaperonin 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=groL1 PE=3 SV=1 36 566 0.0E+00
sp|A1AST1|CH60_PELPD 60 kDa chaperonin OS=Pelobacter propionicus (strain DSM 2379) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q2IV30|CH602_RHOP2 60 kDa chaperonin 2 OS=Rhodopseudomonas palustris (strain HaA2) GN=groL2 PE=3 SV=1 33 564 0.0E+00
sp|Q11U19|CH60_CYTH3 60 kDa chaperonin OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=groL PE=3 SV=1 36 567 0.0E+00
sp|Q0KDR7|CH60_CUPNH 60 kDa chaperonin OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|A3PID0|CH60_RHOS1 60 kDa chaperonin OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q0C0T0|CH60_HYPNA 60 kDa chaperonin OS=Hyphomonas neptunium (strain ATCC 15444) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|A1K436|CH601_AZOSB 60 kDa chaperonin 1 OS=Azoarcus sp. (strain BH72) GN=groL1 PE=3 SV=1 36 565 0.0E+00
sp|A4WUL5|CH60_RHOS5 60 kDa chaperonin OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q93MH1|CH60_RHOPL 60 kDa chaperonin OS=Rhodopseudomonas palustris GN=groL PE=3 SV=1 36 566 0.0E+00
sp|A5G9I2|CH60_GEOUR 60 kDa chaperonin OS=Geobacter uraniireducens (strain Rf4) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|Q0ACQ9|CH60_ALKEH 60 kDa chaperonin OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=groL PE=3 SV=1 36 563 0.0E+00
sp|B3ER92|CH60_AMOA5 60 kDa chaperonin OS=Amoebophilus asiaticus (strain 5a2) GN=groL PE=3 SV=1 36 568 0.0E+00
sp|A8Z640|CH60_SULMW 60 kDa chaperonin OS=Sulcia muelleri (strain GWSS) GN=groL PE=3 SV=1 36 577 0.0E+00
sp|B4S112|CH60_ALTMD 60 kDa chaperonin OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|Q46XW6|CH60_CUPPJ 60 kDa chaperonin OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q95046|CH60_TRYCR Chaperonin HSP60, mitochondrial OS=Trypanosoma cruzi GN=HSP60 PE=2 SV=1 32 566 0.0E+00
sp|Q39727|CH60_EUGGR Chaperonin CPN60, mitochondrial OS=Euglena gracilis GN=HSP60 PE=2 SV=1 36 560 0.0E+00
sp|B3R2Y3|CH60_CUPTR 60 kDa chaperonin OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q6F8P6|CH60_ACIAD 60 kDa chaperonin OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=groL PE=3 SV=1 33 569 0.0E+00
sp|P25420|CH63_HELVI 63 kDa chaperonin, mitochondrial OS=Heliothis virescens PE=1 SV=1 10 576 0.0E+00
sp|Q162U5|CH602_ROSDO 60 kDa chaperonin 2 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=groL2 PE=3 SV=1 36 562 0.0E+00
sp|C1A8L8|CH60_GEMAT 60 kDa chaperonin OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q212H2|CH601_RHOPB 60 kDa chaperonin 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=groL1 PE=3 SV=1 33 564 0.0E+00
sp|A1B877|CH60_PARDP 60 kDa chaperonin OS=Paracoccus denitrificans (strain Pd 1222) GN=groL1 PE=3 SV=1 36 566 0.0E+00
sp|Q9Z462|CH60_PARDE 60 kDa chaperonin OS=Paracoccus denitrificans GN=groL PE=1 SV=2 36 566 0.0E+00
sp|Q12FH7|CH60_POLSJ 60 kDa chaperonin OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|A9M0Q6|CH60_NEIM0 60 kDa chaperonin OS=Neisseria meningitidis serogroup C (strain 053442) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|Q07PA9|CH602_RHOP5 60 kDa chaperonin 2 OS=Rhodopseudomonas palustris (strain BisA53) GN=groL2 PE=3 SV=1 33 564 0.0E+00
sp|Q5F541|CH60_NEIG1 60 kDa chaperonin OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|B4RRA1|CH60_NEIG2 60 kDa chaperonin OS=Neisseria gonorrhoeae (strain NCCP11945) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|A9HPH6|CH602_GLUDA 60 kDa chaperonin 2 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=groL2 PE=3 SV=1 36 558 0.0E+00
sp|Q4ZP20|CH60_PSEU2 60 kDa chaperonin OS=Pseudomonas syringae pv. syringae (strain B728a) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|B9MDC5|CH60_ACIET 60 kDa chaperonin OS=Acidovorax ebreus (strain TPSY) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q28LY7|CH60_JANSC 60 kDa chaperonin OS=Jannaschia sp. (strain CCS1) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|P42385|CH60_NEIMB 60 kDa chaperonin OS=Neisseria meningitidis serogroup B (strain MC58) GN=groL PE=1 SV=2 36 569 0.0E+00
sp|A9I685|CH60_BORPD 60 kDa chaperonin OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q1WSW0|CH60_LACS1 60 kDa chaperonin OS=Lactobacillus salivarius (strain UCC118) GN=groL PE=3 SV=1 36 577 0.0E+00
sp|Q30YH6|CH60_DESAG 60 kDa chaperonin OS=Desulfovibrio alaskensis (strain G20) GN=groL PE=3 SV=1 33 570 0.0E+00
sp|Q1H4F2|CH60_METFK 60 kDa chaperonin OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=groL PE=3 SV=1 36 581 0.0E+00
sp|Q7NQX1|CH602_CHRVO 60 kDa chaperonin 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=groL2 PE=3 SV=1 36 565 0.0E+00
sp|Q2LPJ8|CH601_SYNAS 60 kDa chaperonin 1 OS=Syntrophus aciditrophicus (strain SB) GN=groL1 PE=3 SV=1 36 580 0.0E+00
sp|C4XGI2|CH60_DESMR 60 kDa chaperonin OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q48EI5|CH60_PSE14 60 kDa chaperonin OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|P29842|CH60_NEIGO 60 kDa chaperonin OS=Neisseria gonorrhoeae GN=groL PE=1 SV=3 36 569 0.0E+00
sp|Q7W134|CH60_BORPA 60 kDa chaperonin OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q7WNS4|CH60_BORBR 60 kDa chaperonin OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|B9LZ35|CH60_GEODF 60 kDa chaperonin OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|A1KW52|CH60_NEIMF 60 kDa chaperonin OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|P57006|CH60_NEIMA 60 kDa chaperonin OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|Q747C7|CH60_GEOSL 60 kDa chaperonin OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=groL PE=3 SV=1 38 565 0.0E+00
sp|B8DJC4|CH60_DESVM 60 kDa chaperonin OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=groL PE=3 SV=1 33 565 0.0E+00
sp|B5YJN3|CH60_THEYD 60 kDa chaperonin OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|C5BP08|CH60_TERTT 60 kDa chaperonin OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=groL PE=3 SV=1 36 567 0.0E+00
sp|Q3J729|CH60_NITOC 60 kDa chaperonin OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|A1W3W8|CH60_ACISJ 60 kDa chaperonin OS=Acidovorax sp. (strain JS42) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|P48210|CH60_BORPE 60 kDa chaperonin OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q31IT1|CH60_THICR 60 kDa chaperonin OS=Thiomicrospira crunogena (strain XCL-2) GN=groL PE=3 SV=1 36 562 0.0E+00
sp|Q5P7G2|CH60_AROAE 60 kDa chaperonin OS=Aromatoleum aromaticum (strain EbN1) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|A1VCQ0|CH60_DESVV 60 kDa chaperonin OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=groL PE=3 SV=1 33 565 0.0E+00
sp|Q72AL6|CH60_DESVH 60 kDa chaperonin OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=groL PE=3 SV=1 33 565 0.0E+00
sp|Q19NJ4|CH602_ECOK1 60 kDa chaperonin 2 OS=Escherichia coli O1:K1 / APEC GN=groL2 PE=3 SV=1 36 570 0.0E+00
sp|A7HAD3|CH601_ANADF 60 kDa chaperonin 1 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=groL1 PE=3 SV=1 36 569 0.0E+00
sp|Q2KXZ3|CH60_BORA1 60 kDa chaperonin OS=Bordetella avium (strain 197N) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q5LV15|CH60_RUEPO 60 kDa chaperonin OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q87X14|CH60_PSESM 60 kDa chaperonin OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|A0M7D9|CH60_GRAFK 60 kDa chaperonin OS=Gramella forsetii (strain KT0803) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q21ZD1|CH601_RHOFT 60 kDa chaperonin 1 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=groL1 PE=3 SV=1 36 566 0.0E+00
sp|P31293|CH60_ALLVI 60 kDa chaperonin OS=Allochromatium vinosum GN=groL PE=1 SV=1 33 564 0.0E+00
sp|Q4FU94|CH60_PSYA2 60 kDa chaperonin OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=groL PE=3 SV=1 36 563 0.0E+00
sp|A0LEH2|CH601_SYNFM 60 kDa chaperonin 1 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=groL1 PE=3 SV=1 36 564 0.0E+00
sp|Q73NH7|CH60_TREDE 60 kDa chaperonin OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=groL PE=3 SV=1 36 575 0.0E+00
sp|B3E8G0|CH60_GEOLS 60 kDa chaperonin OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=groL PE=3 SV=1 33 566 0.0E+00
sp|B3DZP5|CH60_METI4 60 kDa chaperonin OS=Methylacidiphilum infernorum (isolate V4) GN=groL PE=3 SV=1 36 580 0.0E+00
sp|Q67KB8|CH60_SYMTH 60 kDa chaperonin OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=groL PE=3 SV=1 33 569 0.0E+00
sp|A2SCV1|CH60_METPP 60 kDa chaperonin OS=Methylibium petroleiphilum (strain PM1) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A6VM38|CH60_ACTSZ 60 kDa chaperonin OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|B9KCR7|CH60_CAMLR 60 kDa chaperonin OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|Q1QDC9|CH60_PSYCK 60 kDa chaperonin OS=Psychrobacter cryohalolentis (strain K5) GN=groL PE=3 SV=1 36 563 0.0E+00
sp|B8F865|CH60_HAEPS 60 kDa chaperonin OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|B2V8F1|CH60_SULSY 60 kDa chaperonin OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|Q7M7I7|CH601_VIBVY 60 kDa chaperonin 1 OS=Vibrio vulnificus (strain YJ016) GN=groL1 PE=3 SV=1 36 566 0.0E+00
sp|Q9ALA9|CH601_VIBVU 60 kDa chaperonin 1 OS=Vibrio vulnificus (strain CMCP6) GN=groL1 PE=3 SV=2 36 566 0.0E+00
sp|A1TKQ5|CH60_ACIAC 60 kDa chaperonin OS=Acidovorax citrulli (strain AAC00-1) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|B0VSP5|CH60_ACIBS 60 kDa chaperonin OS=Acinetobacter baumannii (strain SDF) GN=groL PE=3 SV=1 33 569 0.0E+00
sp|B2GAI0|CH60_LACF3 60 kDa chaperonin OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=groL PE=3 SV=1 36 580 0.0E+00
sp|B0VDR6|CH60_ACIBY 60 kDa chaperonin OS=Acinetobacter baumannii (strain AYE) GN=groL PE=3 SV=1 33 569 0.0E+00
sp|A3M836|CH60_ACIBT 60 kDa chaperonin OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=groL PE=3 SV=2 33 569 0.0E+00
sp|B7I618|CH60_ACIB5 60 kDa chaperonin OS=Acinetobacter baumannii (strain AB0057) GN=groL PE=3 SV=1 33 569 0.0E+00
sp|B7GY36|CH60_ACIB3 60 kDa chaperonin OS=Acinetobacter baumannii (strain AB307-0294) GN=groL PE=3 SV=1 33 569 0.0E+00
sp|B3PLM6|CH60_CELJU 60 kDa chaperonin OS=Cellvibrio japonicus (strain Ueda107) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|B2HXB6|CH60_ACIBC 60 kDa chaperonin OS=Acinetobacter baumannii (strain ACICU) GN=groL PE=3 SV=1 33 569 0.0E+00
sp|B7GFR6|CH60_ANOFW 60 kDa chaperonin OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=groL PE=3 SV=1 36 577 0.0E+00
sp|B0USK6|CH60_HISS2 60 kDa chaperonin OS=Histophilus somni (strain 2336) GN=groL PE=3 SV=1 33 565 0.0E+00
sp|Q0I284|CH60_HAES1 60 kDa chaperonin OS=Haemophilus somnus (strain 129Pt) GN=groL PE=3 SV=1 33 565 0.0E+00
sp|Q07201|CH60_GEOSE 60 kDa chaperonin OS=Geobacillus stearothermophilus GN=groL PE=2 SV=1 36 587 0.0E+00
sp|C5D4F4|CH60_GEOSW 60 kDa chaperonin OS=Geobacillus sp. (strain WCH70) GN=groL PE=3 SV=1 36 587 0.0E+00
sp|P48215|CH60_NEIFL 60 kDa chaperonin OS=Neisseria flavescens GN=groL PE=3 SV=1 36 569 0.0E+00
sp|A4IJV3|CH60_GEOTN 60 kDa chaperonin OS=Geobacillus thermodenitrificans (strain NG80-2) GN=groL PE=3 SV=1 36 577 0.0E+00
sp|Q2RL13|CH601_MOOTA 60 kDa chaperonin 1 OS=Moorella thermoacetica (strain ATCC 39073) GN=groL1 PE=3 SV=1 36 574 0.0E+00
sp|A6T1E5|CH60_JANMA 60 kDa chaperonin OS=Janthinobacterium sp. (strain Marseille) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|B1XXY9|CH60_LEPCP 60 kDa chaperonin OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|A1VJZ8|CH602_POLNA 60 kDa chaperonin 2 OS=Polaromonas naphthalenivorans (strain CJ2) GN=groL2 PE=3 SV=1 36 564 0.0E+00
sp|A8FMS6|CH60_CAMJ8 60 kDa chaperonin OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|Q87BC0|CH60_XYLFT 60 kDa chaperonin OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|B2I7D4|CH60_XYLF2 60 kDa chaperonin OS=Xylella fastidiosa (strain M23) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q13IM9|CH605_BURXL 60 kDa chaperonin 5 OS=Burkholderia xenovorans (strain LB400) GN=groL5 PE=3 SV=1 36 566 0.0E+00
sp|Q8KM30|CH60_OLEAN 60 kDa chaperonin OS=Oleispira antarctica GN=groL PE=3 SV=1 36 565 0.0E+00
sp|A7H2F8|CH60_CAMJD 60 kDa chaperonin OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|Q1LQS4|CH60_CUPMC 60 kDa chaperonin OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q37683|CH60_TRYBB Chaperonin HSP60, mitochondrial OS=Trypanosoma brucei brucei GN=HSP60 PE=2 SV=2 31 564 0.0E+00
sp|A1W0K4|CH60_CAMJJ 60 kDa chaperonin OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|O69289|CH60_CAMJE 60 kDa chaperonin OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=groL PE=3 SV=2 36 571 0.0E+00
sp|Q9PFP2|CH60_XYLFA 60 kDa chaperonin OS=Xylella fastidiosa (strain 9a5c) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|A1WL05|CH60_VEREI 60 kDa chaperonin OS=Verminephrobacter eiseniae (strain EF01-2) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q30SX1|CH60_SULDN 60 kDa chaperonin OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|O33500|CH60_PSEST 60 kDa chaperonin OS=Pseudomonas stutzeri GN=groL PE=3 SV=1 36 566 0.0E+00
sp|A3QA46|CH60_SHELP 60 kDa chaperonin OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=groL PE=3 SV=1 36 568 0.0E+00
sp|A5CZ03|CH60_PELTS 60 kDa chaperonin OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q5HTP2|CH60_CAMJR 60 kDa chaperonin OS=Campylobacter jejuni (strain RM1221) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|A4G837|CH60_HERAR 60 kDa chaperonin OS=Herminiimonas arsenicoxydans GN=groL PE=3 SV=1 36 565 0.0E+00
sp|B0BPV1|CH60_ACTPJ 60 kDa chaperonin OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|B3H1P4|CH60_ACTP7 60 kDa chaperonin OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|Q5L3E6|CH60_GEOKA 60 kDa chaperonin OS=Geobacillus kaustophilus (strain HTA426) GN=groL PE=3 SV=1 36 577 0.0E+00
sp|Q0VRW6|CH60_ALCBS 60 kDa chaperonin OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|P94166|CH60_ACTPL 60 kDa chaperonin OS=Actinobacillus pleuropneumoniae GN=groL PE=3 SV=3 36 569 0.0E+00
sp|Q9ANR9|CH60_WIGBR 60 kDa chaperonin OS=Wigglesworthia glossinidia brevipalpis GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q65VE4|CH60_MANSM 60 kDa chaperonin OS=Mannheimia succiniciproducens (strain MBEL55E) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|C5CPP8|CH60_VARPS 60 kDa chaperonin OS=Variovorax paradoxus (strain S110) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q1ISQ0|CH60_KORVE 60 kDa chaperonin OS=Koribacter versatilis (strain Ellin345) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|A0AXY5|CH602_BURCH 60 kDa chaperonin 2 OS=Burkholderia cenocepacia (strain HI2424) GN=groL2 PE=3 SV=1 36 564 0.0E+00
sp|A5F4Y1|CH602_VIBC3 60 kDa chaperonin 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=groL2 PE=3 SV=1 36 570 0.0E+00
sp|Q13NE4|CH604_BURXL 60 kDa chaperonin 4 OS=Burkholderia xenovorans (strain LB400) GN=groL4 PE=3 SV=1 36 564 0.0E+00
sp|Q8Y1P8|CH60_RALSO 60 kDa chaperonin OS=Ralstonia solanacearum (strain GMI1000) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A4SZV4|CH60_POLSQ 60 kDa chaperonin OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|A4VP82|CH60_PSEU5 60 kDa chaperonin OS=Pseudomonas stutzeri (strain A1501) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|Q391Y9|CH601_BURL3 60 kDa chaperonin 1 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=groL1 PE=3 SV=1 36 564 0.0E+00
sp|Q9KNR7|CH601_VIBCH 60 kDa chaperonin 1 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=groL1 PE=3 SV=1 36 570 0.0E+00
sp|P19421|CH60_COXBU 60 kDa chaperonin OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=groL PE=1 SV=1 36 570 0.0E+00
sp|A9KC15|CH60_COXBN 60 kDa chaperonin OS=Coxiella burnetii (strain Dugway 5J108-111) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|B6J2I0|CH60_COXB2 60 kDa chaperonin OS=Coxiella burnetii (strain CbuG_Q212) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|B6J4T4|CH60_COXB1 60 kDa chaperonin OS=Coxiella burnetii (strain CbuK_Q154) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q47IZ8|CH60_DECAR 60 kDa chaperonin OS=Dechloromonas aromatica (strain RCB) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|A9NA82|CH60_COXBR 60 kDa chaperonin OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q7NT31|CH601_CHRVO 60 kDa chaperonin 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=groL1 PE=3 SV=1 36 570 0.0E+00
sp|B4S6H2|CH60_PROA2 60 kDa chaperonin OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=groL PE=3 SV=1 33 566 0.0E+00
sp|B6YQT0|CH60_AZOPC 60 kDa chaperonin OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A7MX54|CH60_VIBCB 60 kDa chaperonin OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A5WD52|CH60_PSYWF 60 kDa chaperonin OS=Psychrobacter sp. (strain PRwf-1) GN=groL PE=3 SV=1 36 563 0.0E+00
sp|B1XRX1|CH60_POLNS 60 kDa chaperonin OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q9L7P5|CH601_VIBPA 60 kDa chaperonin 1 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=groL1 PE=3 SV=2 36 566 0.0E+00
sp|O66206|CH60_SERMA 60 kDa chaperonin (Fragment) OS=Serratia marcescens GN=groL PE=3 SV=1 36 579 0.0E+00
sp|Q1QVJ7|CH60_CHRSD 60 kDa chaperonin OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|A3N120|CH60_ACTP2 60 kDa chaperonin OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|B1KIR6|CH60_SHEWM 60 kDa chaperonin OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|B5EN19|CH60_ACIF5 60 kDa chaperonin OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|B7J561|CH60_ACIF2 60 kDa chaperonin OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q9XCA9|CH60_RHOMR 60 kDa chaperonin OS=Rhodothermus marinus GN=groL PE=3 SV=1 36 574 0.0E+00
sp|Q2T3W7|CH602_BURTA 60 kDa chaperonin 2 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=groL2 PE=3 SV=1 36 581 0.0E+00
sp|A7ZCV2|CH60_CAMC1 60 kDa chaperonin OS=Campylobacter concisus (strain 13826) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|B4U8T6|CH60_HYDS0 60 kDa chaperonin OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|B8J123|CH60_DESDA 60 kDa chaperonin OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=groL PE=3 SV=1 33 565 0.0E+00
sp|A1WZJ2|CH60_HALHL 60 kDa chaperonin OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|B9L698|CH60_NAUPA 60 kDa chaperonin OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q2LTG7|CH602_SYNAS 60 kDa chaperonin 2 OS=Syntrophus aciditrophicus (strain SB) GN=groL2 PE=3 SV=1 36 565 0.0E+00
sp|Q1MQP8|CH60_LAWIP 60 kDa chaperonin OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=groL PE=3 SV=1 33 565 0.0E+00
sp|O67943|CH60_AQUAE 60 kDa chaperonin OS=Aquifex aeolicus (strain VF5) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|O66204|CH60_SERFI 60 kDa chaperonin (Fragment) OS=Serratia ficaria GN=groL PE=3 SV=1 36 579 0.0E+00
sp|A8ERY3|CH60_ARCB4 60 kDa chaperonin OS=Arcobacter butzleri (strain RM4018) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|Q3K7L6|CH60_PSEPF 60 kDa chaperonin OS=Pseudomonas fluorescens (strain Pf0-1) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A6QBP8|CH60_SULNB 60 kDa chaperonin OS=Sulfurovum sp. (strain NBC37-1) GN=groL PE=3 SV=1 36 580 0.0E+00
sp|P31294|CH60_HAEDU 60 kDa chaperonin OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=groL PE=3 SV=2 36 564 0.0E+00
sp|Q5QVT4|CH60_IDILO 60 kDa chaperonin OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A6VWY0|CH60_MARMS 60 kDa chaperonin OS=Marinomonas sp. (strain MWYL1) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|Q2Y6I6|CH60_NITMU 60 kDa chaperonin OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|B2KD81|CH60_ELUMP 60 kDa chaperonin OS=Elusimicrobium minutum (strain Pei191) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|A5FIV1|CH60_FLAJ1 60 kDa chaperonin OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|B0U418|CH60_XYLFM 60 kDa chaperonin OS=Xylella fastidiosa (strain M12) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q83WI8|CH601_VIBHA 60 kDa chaperonin 1 OS=Vibrio harveyi GN=groL1 PE=3 SV=1 36 565 0.0E+00
sp|B8CID3|CH60_SHEPW 60 kDa chaperonin OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=groL PE=3 SV=1 33 569 0.0E+00
sp|A7GZ43|CH60_CAMC5 60 kDa chaperonin OS=Campylobacter curvus (strain 525.92) GN=groL PE=3 SV=1 36 574 0.0E+00
sp|O66210|CH60_KLEOX 60 kDa chaperonin (Fragment) OS=Klebsiella oxytoca GN=groL PE=3 SV=1 36 579 0.0E+00
sp|A7GKG0|CH60_BACCN 60 kDa chaperonin OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q4K764|CH60_PSEF5 60 kDa chaperonin OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|C3K1A0|CH60_PSEFS 60 kDa chaperonin OS=Pseudomonas fluorescens (strain SBW25) GN=groL PE=3 SV=1 36 563 0.0E+00
sp|Q15PD3|CH60_PSEA6 60 kDa chaperonin OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q6LM06|CH60_PHOPR 60 kDa chaperonin OS=Photobacterium profundum GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q1C0Y0|CH60_YERPA 60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q12S61|CH60_SHEDO 60 kDa chaperonin OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|P30718|CH60_PSEAE 60 kDa chaperonin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=groL PE=1 SV=3 36 565 0.0E+00
sp|Q02H55|CH60_PSEAB 60 kDa chaperonin OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|B7UZG3|CH60_PSEA8 60 kDa chaperonin OS=Pseudomonas aeruginosa (strain LESB58) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|B1JMR1|CH60_YERPY 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q66FD5|CH60_YERPS 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A4TRR0|CH60_YERPP 60 kDa chaperonin OS=Yersinia pestis (strain Pestoides F) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q1CED4|CH60_YERPN 60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A9QYQ1|CH60_YERPG 60 kDa chaperonin OS=Yersinia pestis bv. Antiqua (strain Angola) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q8ZIY3|CH60_YERPE 60 kDa chaperonin OS=Yersinia pestis GN=groL PE=3 SV=1 36 564 0.0E+00
sp|B2K1Y4|CH60_YERPB 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A7FN01|CH60_YERP3 60 kDa chaperonin OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|C5BDK5|CH60_EDWI9 60 kDa chaperonin OS=Edwardsiella ictaluri (strain 93-146) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q2SDG0|CH60_HAHCH 60 kDa chaperonin OS=Hahella chejuensis (strain KCTC 2396) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q3AR09|CH60_CHLCH 60 kDa chaperonin OS=Chlorobium chlorochromatii (strain CaD3) GN=groL PE=3 SV=1 33 565 0.0E+00
sp|A4XYM0|CH60_PSEMY 60 kDa chaperonin OS=Pseudomonas mendocina (strain ymp) GN=groL PE=3 SV=1 33 570 0.0E+00
sp|Q9XAU7|CH60_PSEHT 60 kDa chaperonin OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=groL PE=3 SV=2 36 566 0.0E+00
sp|A6VB57|CH60_PSEA7 60 kDa chaperonin OS=Pseudomonas aeruginosa (strain PA7) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q8VV84|CH60_GEOTM 60 kDa chaperonin OS=Geobacillus thermoglucosidasius GN=groL PE=3 SV=1 36 574 0.0E+00
sp|C6DY43|CH60_GEOSM 60 kDa chaperonin OS=Geobacter sp. (strain M21) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q5N3T6|CH602_SYNP6 60 kDa chaperonin 2 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=groL2 PE=3 SV=1 36 569 0.0E+00
sp|O66212|CH60_RAOPL 60 kDa chaperonin (Fragment) OS=Raoultella planticola GN=groL PE=3 SV=1 36 579 0.0E+00
sp|A8G8S7|CH60_SERP5 60 kDa chaperonin OS=Serratia proteamaculans (strain 568) GN=groL PE=3 SV=1 36 563 0.0E+00
sp|A5UH48|CH60_HAEIG 60 kDa chaperonin OS=Haemophilus influenzae (strain PittGG) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q0HZ97|CH60_SHESR 60 kDa chaperonin OS=Shewanella sp. (strain MR-7) GN=groL PE=3 SV=1 36 563 0.0E+00
sp|Q0HEQ4|CH60_SHESM 60 kDa chaperonin OS=Shewanella sp. (strain MR-4) GN=groL PE=3 SV=1 36 563 0.0E+00
sp|B5Y894|CH60_COPPD 60 kDa chaperonin OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|Q3JPF6|CH601_BURP1 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 1710b) GN=groL1 PE=3 SV=1 36 564 0.0E+00
sp|A3NYH0|CH601_BURP0 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 1106a) GN=groL1 PE=3 SV=1 36 564 0.0E+00
sp|B5E9Y2|CH60_GEOBB 60 kDa chaperonin OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q8CX48|CH60_SHEON 60 kDa chaperonin OS=Shewanella oneidensis (strain MR-1) GN=groL PE=3 SV=1 36 563 0.0E+00
sp|A1V1Z9|CH60_BURMS 60 kDa chaperonin OS=Burkholderia mallei (strain SAVP1) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q62I82|CH60_BURMA 60 kDa chaperonin OS=Burkholderia mallei (strain ATCC 23344) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A2S9S5|CH60_BURM9 60 kDa chaperonin OS=Burkholderia mallei (strain NCTC 10229) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A3MMB4|CH60_BURM7 60 kDa chaperonin OS=Burkholderia mallei (strain NCTC 10247) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q0BHT1|CH601_BURCM 60 kDa chaperonin 1 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=groL1 PE=3 SV=1 36 564 0.0E+00
sp|Q2IFK0|CH602_ANADE 60 kDa chaperonin 2 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=groL2 PE=3 SV=1 36 569 0.0E+00
sp|Q93EU6|CH60_ENTFA 60 kDa chaperonin OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=groL PE=3 SV=2 36 580 0.0E+00
sp|Q5SLM2|CH60_THET8 60 kDa chaperonin OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=groL PE=1 SV=3 36 577 0.0E+00
sp|P61490|CH60_THET2 60 kDa chaperonin OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=groL PE=1 SV=2 36 577 0.0E+00
sp|A1JIP3|CH60_YERE8 60 kDa chaperonin OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|P58723|CH60_BURTH 60 kDa chaperonin OS=Burkholderia thailandensis GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q2SYJ5|CH601_BURTA 60 kDa chaperonin 1 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=groL1 PE=3 SV=1 36 564 0.0E+00
sp|Q8RIT7|CH60_XANCH 60 kDa chaperonin OS=Xanthomonas campestris pv. phaseoli GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q0B4V5|CH602_BURCM 60 kDa chaperonin 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=groL2 PE=3 SV=1 36 564 0.0E+00
sp|Q3IW60|CH602_RHOS4 60 kDa chaperonin 2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=groL2 PE=3 SV=1 33 580 0.0E+00
sp|A5U9V2|CH60_HAEIE 60 kDa chaperonin OS=Haemophilus influenzae (strain PittEE) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q3BY61|CH60_XANC5 60 kDa chaperonin OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q8PPZ1|CH60_XANAC 60 kDa chaperonin OS=Xanthomonas axonopodis pv. citri (strain 306) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|O66202|CH60_SERRU 60 kDa chaperonin (Fragment) OS=Serratia rubidaea GN=groL PE=3 SV=1 36 576 0.0E+00
sp|O66214|CH60_RAOOR 60 kDa chaperonin (Fragment) OS=Raoultella ornithinolytica GN=groL PE=3 SV=1 36 579 0.0E+00
sp|A0L170|CH60_SHESA 60 kDa chaperonin OS=Shewanella sp. (strain ANA-3) GN=groL PE=3 SV=1 36 563 0.0E+00
sp|Q7MAE3|CH60_WOLSU 60 kDa chaperonin OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=groL PE=3 SV=1 33 571 0.0E+00
sp|Q2NW94|CH60_SODGM 60 kDa chaperonin OS=Sodalis glossinidius (strain morsitans) GN=groL PE=1 SV=1 36 564 0.0E+00
sp|A5W8M6|CH60_PSEP1 60 kDa chaperonin OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|B4SKL8|CH60_STRM5 60 kDa chaperonin OS=Stenotrophomonas maltophilia (strain R551-3) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|P0C193|CH60_SODGL 60 kDa chaperonin OS=Sodalis glossinidius GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q6MBZ5|CH602_PARUW 60 kDa chaperonin 2 OS=Protochlamydia amoebophila (strain UWE25) GN=groL2 PE=3 SV=1 36 572 0.0E+00
sp|Q058F3|CH60_BUCCC 60 kDa chaperonin OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q045Q8|CH60_LACGA 60 kDa chaperonin OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=groL PE=3 SV=1 36 578 0.0E+00
sp|Q88N55|CH60_PSEPK 60 kDa chaperonin OS=Pseudomonas putida (strain KT2440) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q8KJ18|CH60_STRCV 60 kDa chaperonin OS=Streptococcus constellatus GN=groL PE=3 SV=1 36 577 0.0E+00
sp|P0C0Z7|CH60_CHLTR 60 kDa chaperonin OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=groL PE=1 SV=2 36 565 0.0E+00
sp|B7H4Q7|CH60_BACC4 60 kDa chaperonin OS=Bacillus cereus (strain B4264) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|B4EXE2|CH60_PROMH 60 kDa chaperonin OS=Proteus mirabilis (strain HI4320) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q3KMQ9|CH60_CHLTA 60 kDa chaperonin OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=groL PE=2 SV=3 36 565 0.0E+00
sp|Q4QN05|CH60_HAEI8 60 kDa chaperonin OS=Haemophilus influenzae (strain 86-028NP) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|P26209|CH60_BACP3 60 kDa chaperonin OS=Bacillus sp. (strain PS3) GN=groL PE=3 SV=1 36 577 0.0E+00
sp|A8F401|CH60_PSELT 60 kDa chaperonin OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q9F712|CH601_BURPS 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain K96243) GN=groL1 PE=3 SV=2 36 564 0.0E+00
sp|A3NCQ8|CH601_BURP6 60 kDa chaperonin 1 OS=Burkholderia pseudomallei (strain 668) GN=groL1 PE=3 SV=1 36 564 0.0E+00
sp|P31681|CH60_CHLPN 60 kDa chaperonin OS=Chlamydia pneumoniae GN=groL PE=2 SV=2 36 577 0.0E+00
sp|P48219|CH60_YEREN 60 kDa chaperonin OS=Yersinia enterocolitica GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q2IKI2|CH601_ANADE 60 kDa chaperonin 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=groL1 PE=3 SV=1 36 565 0.0E+00
sp|Q5GUT1|CH60_XANOR 60 kDa chaperonin OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|B2SJG4|CH60_XANOP 60 kDa chaperonin OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q2NY29|CH60_XANOM 60 kDa chaperonin OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|P43733|CH60_HAEIN 60 kDa chaperonin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|B2T0I0|CH60_BURPP 60 kDa chaperonin OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|P46398|CH60_AGGAC 60 kDa chaperonin OS=Aggregatibacter actinomycetemcomitans GN=groL PE=1 SV=3 36 564 0.0E+00
sp|Q144Q6|CH601_BURXL 60 kDa chaperonin 1 OS=Burkholderia xenovorans (strain LB400) GN=groL1 PE=3 SV=1 36 564 0.0E+00
sp|O66220|CH60_PECCC 60 kDa chaperonin (Fragment) OS=Pectobacterium carotovorum subsp. carotovorum GN=groL PE=3 SV=1 36 563 0.0E+00
sp|A1SXK4|CH602_PSYIN 60 kDa chaperonin 2 OS=Psychromonas ingrahamii (strain 37) GN=groL2 PE=3 SV=1 36 570 0.0E+00
sp|Q93GW2|CH60_CAMRE 60 kDa chaperonin OS=Campylobacter rectus GN=groL PE=3 SV=1 36 577 0.0E+00
sp|A8FQY1|CH60_SHESH 60 kDa chaperonin OS=Shewanella sediminis (strain HAW-EB3) GN=groL PE=3 SV=1 36 568 0.0E+00
sp|A1ST72|CH601_PSYIN 60 kDa chaperonin 1 OS=Psychromonas ingrahamii (strain 37) GN=groL1 PE=3 SV=1 36 570 0.0E+00
sp|O66222|CH60_ERWAP 60 kDa chaperonin (Fragment) OS=Erwinia aphidicola GN=groL PE=3 SV=1 36 563 0.0E+00
sp|A8H8W3|CH60_SHEPA 60 kDa chaperonin OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q6HPC7|CH60_BACHK 60 kDa chaperonin OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q63GV7|CH60_BACCZ 60 kDa chaperonin OS=Bacillus cereus (strain ZK / E33L) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|B9J1H2|CH60_BACCQ 60 kDa chaperonin OS=Bacillus cereus (strain Q1) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|B7HS05|CH60_BACC7 60 kDa chaperonin OS=Bacillus cereus (strain AH187) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|C1EUB1|CH60_BACC3 60 kDa chaperonin OS=Bacillus cereus (strain 03BB102) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q73ER9|CH60_BACC1 60 kDa chaperonin OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=groL PE=3 SV=2 36 570 0.0E+00
sp|B7JM60|CH60_BACC0 60 kDa chaperonin OS=Bacillus cereus (strain AH820) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|A0R8W4|CH60_BACAH 60 kDa chaperonin OS=Bacillus thuringiensis (strain Al Hakam) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|A1SAC0|CH60_SHEAM 60 kDa chaperonin OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=groL PE=3 SV=1 36 563 0.0E+00
sp|A6WJ17|CH60_SHEB8 60 kDa chaperonin OS=Shewanella baltica (strain OS185) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|A7MMC0|CH60_CROS8 60 kDa chaperonin OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q7M7I2|CH602_VIBVY 60 kDa chaperonin 2 OS=Vibrio vulnificus (strain YJ016) GN=groL2 PE=3 SV=1 36 560 0.0E+00
sp|Q8CWJ0|CH602_VIBVU 60 kDa chaperonin 2 OS=Vibrio vulnificus (strain CMCP6) GN=groL2 PE=3 SV=1 36 560 0.0E+00
sp|B7IUT0|CH60_BACC2 60 kDa chaperonin OS=Bacillus cereus (strain G9842) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|B0KFQ2|CH60_PSEPG 60 kDa chaperonin OS=Pseudomonas putida (strain GB-1) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|P15599|CH601_CHLCV 60 kDa chaperonin 1 OS=Chlamydophila caviae (strain GPIC) GN=groL1 PE=2 SV=1 36 575 0.0E+00
sp|Q6D9J0|CH60_PECAS 60 kDa chaperonin OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=groL PE=3 SV=1 36 572 0.0E+00
sp|C6DKC7|CH60_PECCP 60 kDa chaperonin OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|A0AKH5|CH60_LISW6 60 kDa chaperonin OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|A1RNN6|CH60_SHESW 60 kDa chaperonin OS=Shewanella sp. (strain W3-18-1) GN=groL PE=3 SV=1 36 563 0.0E+00
sp|Q9AGE6|CH60_LISMO 60 kDa chaperonin OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|B8DH59|CH60_LISMH 60 kDa chaperonin OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|Q71XU6|CH60_LISMF 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain F2365) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|C1KX21|CH60_LISMC 60 kDa chaperonin OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=groL PE=3 SV=1 36 569 0.0E+00
sp|B0TVL3|CH60_SHEHH 60 kDa chaperonin OS=Shewanella halifaxensis (strain HAW-EB4) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q8PD23|CH60_XANCP 60 kDa chaperonin OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q4UZA7|CH60_XANC8 60 kDa chaperonin OS=Xanthomonas campestris pv. campestris (strain 8004) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q1D2S1|CH602_MYXXD 60 kDa chaperonin 2 OS=Myxococcus xanthus (strain DK 1622) GN=groL2 PE=3 SV=1 36 569 0.0E+00
sp|Q255A1|CH60_CHLFF 60 kDa chaperonin OS=Chlamydophila felis (strain Fe/C-56) GN=groL PE=3 SV=1 36 575 0.0E+00
sp|A3D8W9|CH60_SHEB5 60 kDa chaperonin OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q59322|CH60_CHLMU 60 kDa chaperonin OS=Chlamydia muridarum (strain MoPn / Nigg) GN=groL PE=2 SV=3 36 565 0.0E+00
sp|Q8DMD4|CH60_THEEB 60 kDa chaperonin OS=Thermosynechococcus elongatus (strain BP-1) GN=groL PE=3 SV=1 36 579 0.0E+00
sp|A0RNU3|CH60_CAMFF 60 kDa chaperonin OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q814B0|CH60_BACCR 60 kDa chaperonin OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q81VE1|CH60_BACAN 60 kDa chaperonin OS=Bacillus anthracis GN=groL PE=3 SV=1 36 570 0.0E+00
sp|C3L507|CH60_BACAC 60 kDa chaperonin OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|C3PAV1|CH60_BACAA 60 kDa chaperonin OS=Bacillus anthracis (strain A0248) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q9WYX6|CH60_THEMA 60 kDa chaperonin OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|Q7MBB4|CH602_GLOVI 60 kDa chaperonin 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=groL2 PE=3 SV=1 36 568 0.0E+00
sp|A4Y398|CH60_SHEPC 60 kDa chaperonin OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=groL PE=3 SV=1 36 563 0.0E+00
sp|B2VL84|CH60_ERWT9 60 kDa chaperonin OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=groL PE=3 SV=1 36 572 0.0E+00
sp|Q9ZFE0|CH60_BURCE 60 kDa chaperonin OS=Burkholderia cepacia GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q21MD3|CH60_SACD2 60 kDa chaperonin OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|B3EGF4|CH60_CHLL2 60 kDa chaperonin OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=groL PE=3 SV=1 33 566 0.0E+00
sp|Q1LSP5|CH60_BAUCH 60 kDa chaperonin OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q39J12|CH602_BURL3 60 kDa chaperonin 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=groL2 PE=3 SV=1 36 564 0.0E+00
sp|B1L8Y8|CH60_THESQ 60 kDa chaperonin OS=Thermotoga sp. (strain RQ2) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|A5IJR6|CH60_THEP1 60 kDa chaperonin OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=groL PE=3 SV=1 36 571 0.0E+00
sp|B1J3K5|CH60_PSEPW 60 kDa chaperonin OS=Pseudomonas putida (strain W619) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|B0RN52|CH60_XANCB 60 kDa chaperonin OS=Xanthomonas campestris pv. campestris (strain B100) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|Q2LU42|CH603_SYNAS 60 kDa chaperonin 3 OS=Syntrophus aciditrophicus (strain SB) GN=groL3 PE=3 SV=1 36 558 0.0E+00
sp|Q1I5E2|CH60_PSEE4 60 kDa chaperonin OS=Pseudomonas entomophila (strain L48) GN=groL PE=3 SV=1 36 565 0.0E+00
sp|Q88YM5|CH60_LACPL 60 kDa chaperonin OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=groL PE=3 SV=1 36 580 0.0E+00
sp|Q4MPR6|CH60_BACCE 60 kDa chaperonin OS=Bacillus cereus GN=groL PE=1 SV=3 36 570 0.0E+00
sp|Q6MRI1|CH60_BDEBA 60 kDa chaperonin OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=groL PE=3 SV=1 36 573 0.0E+00
sp|A9VQG8|CH60_BACWK 60 kDa chaperonin OS=Bacillus weihenstephanensis (strain KBAB4) GN=groL PE=3 SV=1 36 570 0.0E+00
sp|B2FIU9|CH60_STRMK 60 kDa chaperonin OS=Stenotrophomonas maltophilia (strain K279a) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|B3QPB5|CH60_CHLP8 60 kDa chaperonin OS=Chlorobaculum parvum (strain NCIB 8327) GN=groL PE=3 SV=1 36 566 0.0E+00
sp|Q3A0V2|CH60_PELCD 60 kDa chaperonin OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=groL PE=3 SV=1 33 566 0.0E+00
sp|Q03SQ9|CH60_LACBA 60 kDa chaperonin OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=groL PE=3 SV=1 36 580 0.0E+00
sp|B0TX65|CH60_FRAP2 60 kDa chaperonin OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|Q9ZFD8|CH60_BURVI 60 kDa chaperonin OS=Burkholderia vietnamiensis GN=groL PE=3 SV=1 36 564 0.0E+00
sp|A4JC03|CH601_BURVG 60 kDa chaperonin 1 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=groL1 PE=3 SV=1 36 564 0.0E+00
sp|Q493W7|CH60_BLOPB 60 kDa chaperonin OS=Blochmannia pennsylvanicus (strain BPEN) GN=groL PE=3 SV=1 36 564 0.0E+00
sp|P95647|CH602_RHOSH 60 kDa chaperonin 2 OS=Rhodobacter sphaeroides GN=groL2 PE=3 SV=1 33 580 0.0E+00
sp|Q929V0|CH60_LISIN 60 kDa chaperonin OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=groL PE=3 SV=1 36 572 0.0E+00
sp|B3ENV7|CH60_CHLPB 60 kDa chaperonin OS=Chlorobium phaeobacteroides (strain BS1) GN=groL PE=3 SV=1 33 564 0.0E+00
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0005488 binding No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0043167 ion binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0008144 drug binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5475
MQRALSSRARASALSSAASRYRAGTGLGQQLRFTHKELKFGVEGRASLLAGVDTLAKAVATTLGPKGRNVLIESS
FGSPKITKDGVTVAKAVTLKDKFENLGARLLQDVASKTNEVAGDGTTTATVLGRAIFSETVKNVAAGCNPMDLRR
GIQAAVDGVVEYLQKNKRDITTSGEIAQVATISANGDKHVGEMIANAMEKVGKEGVITVKEGKTMQDELDVTEGM
RFDRGYVSPYFITDTKSQKVEFENPLILLSEKKISAVQDIIPALEASTQLRRPLVIIAEDIDGEALAVCILNKLR
GQLQVAAVKAPGFGDNRKSILGDIAVLTKGVVFTDELDIKLDKANADMFGSTGSITITKEDTIILNGEGSKDAIS
QRCEQIRGVMNDPSTSEYEKEKLQERLAKLSGGVAVIKVGGSSEVEVSEKKDRFVDALNATRAAVEEGILPGGGT
ALLKASSQALGSIKAANFDQQLGITIVKNAITRPARTIIENAGLEGSVVVGKLTDEHGADFNKGFDSAKGEYVDM
ISAGILDPLKVVRTGLIDASGVASLLGTTEVAIVEAPEEKSGGPPMGGMGGMGGMGGMGGMM*
Coding >Hirsu2|5475
ATGCAGCGCGCACTGAGCTCTCGGGCTCGAGCTTCGGCTCTGTCCTCGGCGGCCTCCAGGTACCGTGCCGGCACC
GGCTTGGGCCAGCAGCTGCGGTTTACCCACAAGGAGCTCAAGTTCGGTGTCGAGGGTCGGGCCTCGCTCCTGGCG
GGCGTCGACACCCTCGCCAAGGCCGTCGCCACGACGCTTGGCCCTAAGGGCCGCAACGTCCTGATCGAGTCCAGC
TTTGGCTCTCCCAAGATCACCAAAGACGGCGTCACCGTGGCCAAGGCCGTCACGCTCAAGGACAAGTTCGAGAAC
CTCGGCGCTCGTTTATTACAAGACGTCGCCTCCAAGACCAACGAGGTCGCCGGTGATGGCACCACCACCGCCACC
GTCCTGGGCCGGGCCATCTTCTCCGAGACGGTCAAGAACGTCGCTGCCGGCTGCAATCCCATGGACCTGCGCCGC
GGCATCCAGGCTGCCGTCGACGGCGTCGTCGAATACCTGCAGAAGAACAAGCGCGACATCACCACGAGCGGGGAG
ATTGCCCAGGTGGCCACCATCAGCGCCAACGGCGACAAGCACGTGGGTGAGATGATTGCCAATGCGATGGAGAAG
GTCGGCAAGGAGGGCGTCATCACCGTCAAGGAGGGCAAGACGATGCAGGACGAGCTCGACGTCACCGAGGGCATG
CGCTTCGACCGTGGCTACGTCTCGCCCTACTTCATCACCGACACCAAGTCGCAGAAGGTCGAGTTTGAGAACCCC
CTGATCCTGCTCTCGGAGAAGAAGATCTCGGCCGTCCAGGACATCATCCCCGCCCTCGAGGCATCTACCCAGTTG
CGCCGGCCCCTGGTCATCATTGCCGAGGACATCGACGGCGAGGCCCTCGCCGTCTGCATTCTCAACAAGCTCCGC
GGCCAGCTCCAGGTCGCTGCCGTTAAGGCGCCCGGCTTCGGTGACAACCGCAAGTCGATCCTGGGCGACATCGCC
GTCCTCACCAAGGGCGTGGTCTTCACCGACGAGCTCGACATCAAGCTCGACAAGGCCAACGCCGACATGTTCGGC
TCCACCGGCTCCATCACCATCACAAAGGAAGACACCATCATCCTCAACGGCGAGGGCAGCAAGGATGCCATCAGC
CAGCGCTGCGAGCAGATCCGCGGCGTCATGAACGACCCCAGCACCTCCGAGTACGAGAAGGAGAAGCTCCAGGAG
CGGCTGGCCAAGCTATCCGGCGGCGTGGCCGTCATCAAGGTCGGCGGCTCGTCCGAGGTGGAGGTGAGCGAGAAG
AAGGACCGCTTCGTCGACGCGCTCAACGCGACGCGTGCCGCCGTCGAGGAGGGCATCTTGCCCGGAGGCGGCACC
GCCCTGCTCAAGGCCTCGAGCCAGGCCCTGGGCAGCATCAAGGCGGCCAACTTTGACCAGCAGCTGGGCATCACC
ATTGTCAAGAACGCCATCACGCGCCCCGCCCGGACCATCATCGAGAACGCCGGCCTCGAGGGCTCCGTCGTCGTC
GGTAAGCTCACCGACGAGCACGGTGCCGACTTCAACAAGGGCTTCGACAGCGCCAAGGGTGAGTACGTGGACATG
ATCTCGGCCGGCATCCTCGATCCCCTCAAGGTTGTCCGCACCGGCCTCATCGACGCCTCGGGAGTGGCCTCGCTC
CTGGGCACCACCGAAGTGGCCATTGTGGAGGCCCCCGAGGAGAAGTCGGGCGGCCCGCCCATGGGAGGTATGGGC
GGCATGGGTGGCATGGGCGGCATGGGCGGCATGATGTAA
Transcript >Hirsu2|5475
ATGCAGCGCGCACTGAGCTCTCGGGCTCGAGCTTCGGCTCTGTCCTCGGCGGCCTCCAGGTACCGTGCCGGCACC
GGCTTGGGCCAGCAGCTGCGGTTTACCCACAAGGAGCTCAAGTTCGGTGTCGAGGGTCGGGCCTCGCTCCTGGCG
GGCGTCGACACCCTCGCCAAGGCCGTCGCCACGACGCTTGGCCCTAAGGGCCGCAACGTCCTGATCGAGTCCAGC
TTTGGCTCTCCCAAGATCACCAAAGACGGCGTCACCGTGGCCAAGGCCGTCACGCTCAAGGACAAGTTCGAGAAC
CTCGGCGCTCGTTTATTACAAGACGTCGCCTCCAAGACCAACGAGGTCGCCGGTGATGGCACCACCACCGCCACC
GTCCTGGGCCGGGCCATCTTCTCCGAGACGGTCAAGAACGTCGCTGCCGGCTGCAATCCCATGGACCTGCGCCGC
GGCATCCAGGCTGCCGTCGACGGCGTCGTCGAATACCTGCAGAAGAACAAGCGCGACATCACCACGAGCGGGGAG
ATTGCCCAGGTGGCCACCATCAGCGCCAACGGCGACAAGCACGTGGGTGAGATGATTGCCAATGCGATGGAGAAG
GTCGGCAAGGAGGGCGTCATCACCGTCAAGGAGGGCAAGACGATGCAGGACGAGCTCGACGTCACCGAGGGCATG
CGCTTCGACCGTGGCTACGTCTCGCCCTACTTCATCACCGACACCAAGTCGCAGAAGGTCGAGTTTGAGAACCCC
CTGATCCTGCTCTCGGAGAAGAAGATCTCGGCCGTCCAGGACATCATCCCCGCCCTCGAGGCATCTACCCAGTTG
CGCCGGCCCCTGGTCATCATTGCCGAGGACATCGACGGCGAGGCCCTCGCCGTCTGCATTCTCAACAAGCTCCGC
GGCCAGCTCCAGGTCGCTGCCGTTAAGGCGCCCGGCTTCGGTGACAACCGCAAGTCGATCCTGGGCGACATCGCC
GTCCTCACCAAGGGCGTGGTCTTCACCGACGAGCTCGACATCAAGCTCGACAAGGCCAACGCCGACATGTTCGGC
TCCACCGGCTCCATCACCATCACAAAGGAAGACACCATCATCCTCAACGGCGAGGGCAGCAAGGATGCCATCAGC
CAGCGCTGCGAGCAGATCCGCGGCGTCATGAACGACCCCAGCACCTCCGAGTACGAGAAGGAGAAGCTCCAGGAG
CGGCTGGCCAAGCTATCCGGCGGCGTGGCCGTCATCAAGGTCGGCGGCTCGTCCGAGGTGGAGGTGAGCGAGAAG
AAGGACCGCTTCGTCGACGCGCTCAACGCGACGCGTGCCGCCGTCGAGGAGGGCATCTTGCCCGGAGGCGGCACC
GCCCTGCTCAAGGCCTCGAGCCAGGCCCTGGGCAGCATCAAGGCGGCCAACTTTGACCAGCAGCTGGGCATCACC
ATTGTCAAGAACGCCATCACGCGCCCCGCCCGGACCATCATCGAGAACGCCGGCCTCGAGGGCTCCGTCGTCGTC
GGTAAGCTCACCGACGAGCACGGTGCCGACTTCAACAAGGGCTTCGACAGCGCCAAGGGTGAGTACGTGGACATG
ATCTCGGCCGGCATCCTCGATCCCCTCAAGGTTGTCCGCACCGGCCTCATCGACGCCTCGGGAGTGGCCTCGCTC
CTGGGCACCACCGAAGTGGCCATTGTGGAGGCCCCCGAGGAGAAGTCGGGCGGCCCGCCCATGGGAGGTATGGGC
GGCATGGGTGGCATGGGCGGCATGGGCGGCATGATGTAA
Gene >Hirsu2|5475
ATGCAGCGCGCACTGAGCTCTCGGGCTCGAGCTTCGGCTCTGTCCTCGGCGGCCTCCAGGTACCGTGCCGGCACC
GGCTTGGGCCAGCAGCTGCGGTTTACCCACAAGGTGAGTCTGGCCCGGACACGATGCCGCTCTCGGCGGACGCCC
GTCTGACTCGCCCGCCACAGGAGCTCAAGTTCGGTGTCGAGGGTCGGGCCTCGCTCCTGGCGGGCGTCGACACCC
TCGCCAAGGCCGTCGCCACGACGCTTGGCCCTAAGGGCCGCAACGTCCTGATCGAGTCCAGCTTTGGCTCTCCCA
AGATCACCAAAGGTCGGTGCTCGCCGCGCGTGCCTCGGAGAGGGATCGCTTCCGCTGACCACCTGTAGACGGCGT
CACCGTGGCCAAGGCCGTCACGCTCAAGGACAAGTTCGAGAACCTCGGCGCTCGTTTATTACAAGACGTCGCCTC
CAAGACCAACGAGGTCGCCGGTGATGGCACCACCACCGCCACCGTCCTGGGCCGGGCCATCTTCTCCGAGACGGT
CAAGAACGTCGCTGCCGGCTGCAATCCCATGGACCTGCGCCGCGGCATCCAGGCTGCCGTCGACGGCGTCGTCGA
ATACCTGCAGAAGAACAAGCGCGACATCACCACGAGCGGGGAGATTGCCCAGGTGGCCACCATCAGCGCCAACGG
CGACAAGCACGTGGGTGAGATGATTGCCAATGCGATGGAGAAGGTCGGCAAGGAGGGCGTCATCACCGTCAAGGA
GGGCAAGACGATGCAGGACGAGCTCGACGTCACCGAGGGCATGCGCTTCGACCGTGGCTACGTCTCGCCCTACTT
CATCACCGACACCAAGTCGCAGAAGGTCGAGTTTGAGAACCCCCTGATCCTGCTCTCGGAGAAGAAGATCTCGGC
CGTCCAGGACATCATCCCCGCCCTCGAGGCATCTACCCAGTTGCGCCGGCCCCTGGTCATCATTGCCGAGGACAT
CGACGGCGAGGCCCTCGCCGTCTGCATTCTCAACAAGCTCCGCGGCCAGCTCCAGGTCGCTGCCGTTAAGGCGCC
CGGCTTCGGTGACAACCGCAAGTCGATCCTGGGCGACATCGCCGTCCTCACCAAGGGCGTGGTCTTCACCGACGA
GCTCGACATCAAGCTCGACAAGGCCAACGCCGACATGTTCGGCTCCACCGGCTCCATCACCATCACAAAGGAAGA
CACCATCATCCTCAACGGCGAGGGCAGCAAGGATGCCATCAGCCAGCGCTGCGAGCAGATCCGCGGCGTCATGAA
CGACCCCAGCACCTCCGAGTACGAGAAGGAGAAGCTCCAGGAGCGGCTGGCCAAGCTATCCGGCGGCGTGGCCGT
CATCAAGGTCGGCGGCTCGTCCGAGGTGGAGGTGAGCGAGAAGAAGGACCGCTTCGTCGACGCGCTCAACGCGAC
GCGTGCCGCCGTCGAGGAGGGCATCTTGCCCGGAGGCGGCACCGCCCTGCTCAAGGCCTCGAGCCAGGCCCTGGG
CAGCATCAAGGCGGCCAACTTTGACCAGCAGCTGGGCATCACCATTGTCAAGAACGCCATCACGCGCCCCGCCCG
GACCATCATCGAGAACGCCGGCCTCGAGGGCTCCGTCGTCGTCGGTAAGCTCACCGACGAGCACGGTGCCGACTT
CAACAAGGGCTTCGACAGCGCCAAGGGTGAGTACGTGGACATGATCTCGGCCGGCATCCTCGATCCCCTCAAGGT
TGTCCGCACCGGCCTCATCGACGCCTCGGGAGTGGCCTCGCTCCTGGGCACCACCGAAGTGGCCATTGTGGAGGC
CCCCGAGGAGAAGTCGGGCGGCCCGCCCATGGGAGGTATGGGCGGCATGGGTGGCATGGGCGGCATGGGCGGCAT
GATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail