Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5467
Gene name
LocationContig_274:175..2732
Strand-
Gene length (bp)2557
Transcript length (bp)2229
Coding sequence length (bp)2229
Protein length (aa) 743

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00384 Molybdopterin Molybdopterin oxidoreductase 6.9E-71 305 629
PF13510 Fer2_4 2Fe-2S iron-sulfur cluster binding domain 3.2E-20 32 108
PF09326 NADH_dhqG_C NADH-ubiquinone oxidoreductase subunit G, C-terminal 5.0E-19 661 711
PF10588 NADH-G_4Fe-4S_3 NADH-ubiquinone oxidoreductase-G iron-sulfur binding region 2.8E-17 115 152
PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain 3.2E-09 37 98

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P15690|NDUS1_BOVIN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Bos taurus GN=NDUFS1 PE=1 SV=1 26 718 0.0E+00
sp|P24918|NDUS1_NEUCR NADH-ubiquinone oxidoreductase 78 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo78 PE=1 SV=2 1 742 0.0E+00
sp|P29915|NQO3_PARDE NADH-quinone oxidoreductase chain 3 OS=Paracoccus denitrificans GN=nqo3 PE=1 SV=4 35 712 0.0E+00
sp|Q68VV2|NUOG_RICTY NADH-quinone oxidoreductase subunit G OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nuoG PE=3 SV=1 34 715 0.0E+00
sp|Q9ZCF6|NUOG_RICPR NADH-quinone oxidoreductase subunit G OS=Rickettsia prowazekii (strain Madrid E) GN=nuoG PE=3 SV=1 34 714 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P15690|NDUS1_BOVIN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Bos taurus GN=NDUFS1 PE=1 SV=1 26 718 0.0E+00
sp|P24918|NDUS1_NEUCR NADH-ubiquinone oxidoreductase 78 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo78 PE=1 SV=2 1 742 0.0E+00
sp|P29915|NQO3_PARDE NADH-quinone oxidoreductase chain 3 OS=Paracoccus denitrificans GN=nqo3 PE=1 SV=4 35 712 0.0E+00
sp|Q68VV2|NUOG_RICTY NADH-quinone oxidoreductase subunit G OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nuoG PE=3 SV=1 34 715 0.0E+00
sp|Q9ZCF6|NUOG_RICPR NADH-quinone oxidoreductase subunit G OS=Rickettsia prowazekii (strain Madrid E) GN=nuoG PE=3 SV=1 34 714 0.0E+00
sp|Q92G92|NUOG_RICCN NADH-quinone oxidoreductase subunit G OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nuoG PE=3 SV=2 34 719 0.0E+00
sp|Q4UK22|NUOG_RICFE NADH-quinone oxidoreductase subunit G OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nuoG PE=3 SV=1 34 721 0.0E+00
sp|Q1RKD2|NUOG_RICBR NADH-quinone oxidoreductase subunit G OS=Rickettsia bellii (strain RML369-C) GN=nuoG PE=3 SV=1 34 721 0.0E+00
sp|Q9FGI6|NDUS1_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 1, mitochondrial OS=Arabidopsis thaliana GN=EMB1467 PE=1 SV=2 34 713 0.0E+00
sp|O21241|NDUS1_RECAM NADH-ubiquinone oxidoreductase 75 kDa subunit OS=Reclinomonas americana GN=NAD11 PE=3 SV=1 34 713 0.0E+00
sp|Q94511|NDUS1_DROME NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Drosophila melanogaster GN=ND-75 PE=2 SV=3 5 714 0.0E+00
sp|P0CB67|NDUS1_PONAB NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pongo abelii GN=NDUFS1 PE=2 SV=1 26 718 0.0E+00
sp|Q0MQG1|NDUS1_GORGO NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS1 PE=2 SV=1 26 718 0.0E+00
sp|Q4R6K9|NDUS1_MACFA NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Macaca fascicularis GN=NDUFS1 PE=2 SV=1 26 718 0.0E+00
sp|P0CB68|NDUS1_PONPY NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pongo pygmaeus GN=NDUFS1 PE=2 SV=1 26 718 0.0E+00
sp|Q0MQG2|NDUS1_PANTR NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pan troglodytes GN=NDUFS1 PE=2 SV=1 26 718 0.0E+00
sp|P28331|NDUS1_HUMAN NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens GN=NDUFS1 PE=1 SV=3 26 718 0.0E+00
sp|Q66HF1|NDUS1_RAT NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Rattus norvegicus GN=Ndufs1 PE=1 SV=1 1 718 0.0E+00
sp|Q91VD9|NDUS1_MOUSE NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Mus musculus GN=Ndufs1 PE=1 SV=2 1 718 0.0E+00
sp|Q43644|NDUS1_SOLTU NADH dehydrogenase [ubiquinone] iron-sulfur protein 1, mitochondrial OS=Solanum tuberosum PE=2 SV=1 34 713 0.0E+00
sp|Q37373|NDUS1_ACACA NADH-ubiquinone oxidoreductase 75 kDa subunit OS=Acanthamoeba castellanii GN=NAD11 PE=3 SV=1 33 711 8.0E-158
sp|Q34312|NDUS1_DICDI NADH-ubiquinone oxidoreductase 75 kDa subunit OS=Dictyostelium discoideum GN=nad11 PE=3 SV=1 33 708 3.0E-126
sp|Q2LCP5|NDUS1_DICCI NADH-ubiquinone oxidoreductase 75 kDa subunit OS=Dictyostelium citrinum GN=nad11 PE=3 SV=2 33 708 2.0E-122
sp|Q9XAR0|NUOG_STRCO NADH-quinone oxidoreductase subunit G OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nuoG PE=3 SV=1 34 429 9.0E-75
sp|P56914|NUOG2_RHIME NADH-quinone oxidoreductase subunit G 2 OS=Rhizobium meliloti (strain 1021) GN=nuoG2 PE=3 SV=2 34 426 1.0E-69
sp|P9WIV9|NUOG_MYCTU NADH-quinone oxidoreductase subunit G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nuoG PE=1 SV=1 34 436 5.0E-66
sp|P9WIV8|NUOG_MYCTO NADH-quinone oxidoreductase subunit G OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nuoG PE=3 SV=1 34 436 6.0E-66
sp|P59962|NUOG_MYCBO NADH-quinone oxidoreductase subunit G OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nuoG PE=3 SV=1 34 436 6.0E-66
sp|Q56223|NQO3_THET8 NADH-quinone oxidoreductase subunit 3 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=nqo3 PE=1 SV=2 34 638 6.0E-65
sp|Q89AU1|NUOG_BUCBP NADH-quinone oxidoreductase subunit G OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nuoG PE=3 SV=1 36 427 9.0E-52
sp|Q74FU6|SFRA_GEOSL NADPH-Fe(3+) oxidoreductase subunit alpha OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=sfrA PE=1 SV=1 34 436 5.0E-51
sp|D7AF63|SFRA_GEOSK NADPH-Fe(3+) oxidoreductase subunit alpha OS=Geobacter sulfurreducens (strain DL-1 / KN400) GN=sfrA PE=3 SV=1 34 436 5.0E-51
sp|P0A1Y4|NUOG_SALTY NADH-quinone oxidoreductase subunit G OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nuoG PE=3 SV=2 36 427 2.0E-49
sp|P0A1Y5|NUOG_SALTI NADH-quinone oxidoreductase subunit G OS=Salmonella typhi GN=nuoG PE=3 SV=2 36 427 2.0E-49
sp|Q8FFJ9|NUOG_ECOL6 NADH-quinone oxidoreductase subunit G OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nuoG PE=3 SV=3 36 427 3.0E-49
sp|P33602|NUOG_ECOLI NADH-quinone oxidoreductase subunit G OS=Escherichia coli (strain K12) GN=nuoG PE=1 SV=4 36 427 3.0E-49
sp|Q7UC56|NUOG_SHIFL NADH-quinone oxidoreductase subunit G OS=Shigella flexneri GN=nuoG PE=3 SV=3 36 427 3.0E-49
sp|Q8XCX2|NUOG_ECO57 NADH-quinone oxidoreductase subunit G OS=Escherichia coli O157:H7 GN=nuoG PE=3 SV=3 36 427 4.0E-49
sp|P57257|NUOG_BUCAI NADH-quinone oxidoreductase subunit G OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=nuoG PE=3 SV=1 35 411 4.0E-49
sp|Q9KGW3|NUOG_PSEFL NADH-quinone oxidoreductase subunit G OS=Pseudomonas fluorescens GN=nuoG PE=2 SV=1 36 296 7.0E-48
sp|Q8K9Y2|NUOG_BUCAP NADH-quinone oxidoreductase subunit G OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=nuoG PE=3 SV=1 35 606 3.0E-47
sp|Q8ZDL2|NUOG_YERPE NADH-quinone oxidoreductase subunit G OS=Yersinia pestis GN=nuoG PE=3 SV=1 36 606 6.0E-47
sp|Q88FH2|NUOG_PSEPK NADH-quinone oxidoreductase subunit G OS=Pseudomonas putida (strain KT2440) GN=nuoG PE=3 SV=1 36 296 1.0E-46
sp|Q87ZQ4|NUOG_PSESM NADH-quinone oxidoreductase subunit G OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=nuoG PE=3 SV=1 36 311 1.0E-46
sp|Q8EI34|NUOG_SHEON NADH-quinone oxidoreductase subunit G OS=Shewanella oneidensis (strain MR-1) GN=nuoG PE=3 SV=1 36 296 4.0E-46
sp|Q9I0J6|NUOG_PSEAE NADH-quinone oxidoreductase subunit G OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nuoG PE=3 SV=1 36 296 5.0E-46
sp|Q7VRV7|NUOG_BLOFL NADH-quinone oxidoreductase subunit G OS=Blochmannia floridanus GN=nuoG PE=3 SV=1 34 427 3.0E-44
sp|Q46508|HNDD_DESFR NADP-reducing hydrogenase subunit HndC OS=Desulfovibrio fructosivorans GN=hndD PE=1 SV=1 34 249 1.0E-31
sp|Q795Y4|FDHL_BACSU Putative formate dehydrogenase YrhE OS=Bacillus subtilis (strain 168) GN=yrhE PE=3 SV=1 34 662 8.0E-29
sp|Q49ZN0|FDHL_STAS1 Putative formate dehydrogenase SSP0601 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0601 PE=3 SV=1 31 427 6.0E-27
sp|Q6GEC4|FDHL_STAAR Putative formate dehydrogenase SAR2393 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2393 PE=3 SV=1 31 427 1.0E-23
sp|Q5HDP9|FDHL_STAAC Putative formate dehydrogenase SACOL2301 OS=Staphylococcus aureus (strain COL) GN=SACOL2301 PE=3 SV=1 31 427 3.0E-23
sp|Q2FEI5|FDHL_STAA3 Putative formate dehydrogenase SAUSA300_2258 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2258 PE=3 SV=1 31 427 3.0E-23
sp|Q2FVV9|FDHL_STAA8 Putative formate dehydrogenase SAOUHSC_02582 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02582 PE=3 SV=1 31 427 3.0E-23
sp|Q7A057|FDHL_STAAW Putative formate dehydrogenase MW2229 OS=Staphylococcus aureus (strain MW2) GN=MW2229 PE=3 SV=1 31 427 4.0E-23
sp|Q6G711|FDHL_STAAS Putative formate dehydrogenase SAS2201 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2201 PE=3 SV=1 31 427 4.0E-23
sp|Q99RW4|FDHL_STAAN Putative formate dehydrogenase SA2102 OS=Staphylococcus aureus (strain N315) GN=SA2102 PE=1 SV=1 31 427 4.0E-23
sp|Q931G2|FDHL_STAAM Putative formate dehydrogenase SAV2309 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2309 PE=3 SV=1 31 427 4.0E-23
sp|Q2YYT1|FDHL_STAAB Putative formate dehydrogenase SAB2186c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB2186c PE=3 SV=1 31 427 9.0E-23
sp|O34720|YJGC_BACSU Probable oxidoreductase YjgC OS=Bacillus subtilis (strain 168) GN=yjgC PE=3 SV=1 36 427 1.0E-21
sp|P22318|HOXU_CUPNH NAD-reducing hydrogenase HoxS subunit gamma OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hoxU PE=1 SV=2 34 242 5.0E-21
sp|Q4L8G8|FDHL_STAHJ Putative formate dehydrogenase SH0748 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0748 PE=3 SV=1 31 427 1.0E-19
sp|Q60314|Y006_METJA Uncharacterized oxidoreductase MJ0006 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0006 PE=3 SV=1 304 645 2.0E-14
sp|P61159|FDHA_METJA Formate dehydrogenase subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=fdhA PE=3 SV=2 547 653 1.0E-10
sp|Q49ZN0|FDHL_STAS1 Putative formate dehydrogenase SSP0601 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0601 PE=3 SV=1 562 662 6.0E-08
sp|Q7A057|FDHL_STAAW Putative formate dehydrogenase MW2229 OS=Staphylococcus aureus (strain MW2) GN=MW2229 PE=3 SV=1 567 662 1.0E-07
sp|Q931G2|FDHL_STAAM Putative formate dehydrogenase SAV2309 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2309 PE=3 SV=1 567 662 1.0E-07
sp|Q99RW4|FDHL_STAAN Putative formate dehydrogenase SA2102 OS=Staphylococcus aureus (strain N315) GN=SA2102 PE=1 SV=1 567 662 1.0E-07
sp|Q6G711|FDHL_STAAS Putative formate dehydrogenase SAS2201 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2201 PE=3 SV=1 567 662 1.0E-07
sp|Q2FEI5|FDHL_STAA3 Putative formate dehydrogenase SAUSA300_2258 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2258 PE=3 SV=1 567 662 1.0E-07
sp|Q2FVV9|FDHL_STAA8 Putative formate dehydrogenase SAOUHSC_02582 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02582 PE=3 SV=1 567 662 1.0E-07
sp|Q5HDP9|FDHL_STAAC Putative formate dehydrogenase SACOL2301 OS=Staphylococcus aureus (strain COL) GN=SACOL2301 PE=3 SV=1 567 662 1.0E-07
sp|Q2YYT1|FDHL_STAAB Putative formate dehydrogenase SAB2186c OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=SAB2186c PE=3 SV=1 567 653 2.0E-07
sp|O34720|YJGC_BACSU Probable oxidoreductase YjgC OS=Bacillus subtilis (strain 168) GN=yjgC PE=3 SV=1 567 653 2.0E-07
sp|Q4L8G8|FDHL_STAHJ Putative formate dehydrogenase SH0748 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0748 PE=3 SV=1 549 657 2.0E-07
sp|P39458|NARB_SYNE7 Nitrate reductase OS=Synechococcus elongatus (strain PCC 7942) GN=narB PE=1 SV=2 548 644 4.0E-07
sp|P06131|FDHA_METFO Formate dehydrogenase subunit alpha OS=Methanobacterium formicicum GN=fdhA PE=1 SV=1 567 634 8.0E-07
sp|Q6GEC4|FDHL_STAAR Putative formate dehydrogenase SAR2393 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2393 PE=3 SV=1 567 653 1.0E-06
sp|P29166|PHF1_CLOPA Iron hydrogenase 1 OS=Clostridium pasteurianum PE=1 SV=1 36 245 1.0E-06
sp|P42434|NASC_BACSU Assimilatory nitrate reductase catalytic subunit OS=Bacillus subtilis (strain 168) GN=nasC PE=2 SV=3 579 633 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0016651 oxidoreductase activity, acting on NAD(P)H Yes
GO:0009055 electron transfer activity Yes
GO:0055114 oxidation-reduction process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:0051540 metal cluster binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5467
MLRYSLARSAWRTGRRAARPARAFATTTRRQAEVELTIDGKKVSIEAGSALIQACEKAGVTIPRFCYHEKLMIAG
NCRMCLVEVERAPKPVASCAWPVQPGMVVKTNSPLTHKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMRYGA
DRGRFHEIGGKRAVEDKNIGPLIKTSMNRCIHCTRCVRFANDVAGAPELGSTGRGNDLQIGTYLEKNLDSELSAN
VIDLCPVGALTSKPYAFRARPWELKHTESVDVLDGLGSNIRVDSRGLEVMRVLPRLNDDVNEEWINDKTRFACDG
LKTQRLTMPLVRREGRFEPADWEEALAEVARAWERRKPQGNEFKIVAGALTEVESLVVAKDMANKLGSDNLALDM
PSGSQPLAHGVDVRSNYLFNSRIWGIEEADCMLIVGSNPRHEAAVLNARIRKQWLRSDLEIGVVGQTWDSTFEFE
HLGTDHASLKKALAGPFGKKLQAAKRPMIIVGSGVTDHGDAKAFYETIGAFVEKNSANFLTDEWDGYNVLQREAS
RAGAFEVGFVTPSAAVAETKPKFLWLLGADEMDETDIPKDAFVVYQGHHGDRGAQMADVILPGAAYTEKAGTYVN
TEGRVQMTRAATSLPGAARTDWKILRAASEFLGAPLPYDDVAAVRDRMADISPALTAYDVVEPVSLRQLSKVQLV
DQNRGAKVGGSPLKKTIENFYFTDVISRSSPTMARCSAAKATGDPRTNLMAPGMEEDKPMGQVAYGA*
Coding >Hirsu2|5467
ATGCTTCGATACTCTCTGGCACGTTCGGCTTGGAGGACGGGCAGGCGGGCCGCCCGTCCCGCGCGGGCCTTTGCG
ACTACAACACGGCGCCAGGCCGAGGTGGAATTGACGATTGACGGGAAGAAGGTCTCCATTGAAGCTGGCTCCGCC
TTGATCCAAGCTTGCGAGAAGGCTGGCGTTACGATTCCCAGATTTTGCTACCATGAGAAGCTCATGATTGCTGGT
AATTGCCGCATGTGCCTGGTCGAGGTGGAGAGGGCACCGAAGCCTGTGGCCTCGTGCGCCTGGCCAGTACAGCCC
GGCATGGTGGTCAAGACCAACTCGCCGCTGACCCACAAGGCTCGCGAGGGCGTCATGGAGTTCCTCCTAGCCAAC
CATCCGCTCGACTGTCCCATCTGCGACCAGGGCGGCGAGTGCGACCTACAAGACCAATCGATGCGCTACGGGGCC
GACCGGGGCCGATTCCACGAGATCGGAGGCAAGCGTGCCGTCGAGGACAAGAACATCGGGCCCTTGATCAAGACG
TCGATGAACCGATGCATCCACTGCACGAGATGCGTGCGGTTCGCCAACGACGTCGCCGGTGCTCCCGAGCTCGGC
TCTACGGGCCGAGGCAACGACCTGCAGATCGGGACGTACCTCGAGAAGAACTTGGACTCGGAGCTCTCCGCCAAC
GTCATCGACCTCTGCCCCGTCGGCGCCCTGACCTCGAAGCCGTATGCCTTCCGGGCCCGTCCCTGGGAACTGAAG
CACACCGAGTCCGTCGACGTCCTCGACGGCCTGGGCTCCAACATCCGCGTCGATTCGAGGGGCCTCGAGGTGATG
CGCGTCCTCCCTCGCCTCAACGACGACGTCAACGAGGAGTGGATCAACGACAAGACCAGATTCGCGTGCGACGGC
CTCAAGACGCAGCGCCTGACGATGCCCCTGGTCCGGCGAGAGGGCAGGTTCGAGCCGGCCGACTGGGAGGAGGCG
CTGGCCGAGGTGGCCCGGGCCTGGGAGCGGAGGAAGCCGCAGGGCAACGAGTTCAAGATCGTTGCCGGCGCCCTG
ACCGAGGTCGAGTCTCTCGTCGTCGCCAAGGACATGGCCAACAAGCTCGGGTCCGACAACCTGGCCCTGGACATG
CCGAGCGGAAGCCAGCCTCTCGCACACGGCGTCGACGTGCGGTCAAACTACCTGTTCAACTCGAGGATCTGGGGC
ATCGAGGAGGCGGACTGCATGCTGATCGTCGGAAGCAATCCGCGGCACGAGGCGGCCGTCCTCAACGCCCGCATC
CGGAAACAGTGGCTCCGCTCCGACCTCGAGATTGGCGTCGTCGGCCAGACGTGGGACTCGACCTTTGAGTTTGAG
CATCTCGGGACCGACCACGCGTCGCTGAAAAAGGCGCTGGCCGGTCCGTTCGGCAAGAAGCTGCAGGCGGCGAAG
AGGCCCATGATCATCGTGGGCTCCGGCGTGACGGACCACGGCGACGCCAAGGCCTTTTACGAGACCATCGGGGCC
TTCGTGGAGAAGAACTCGGCCAACTTCCTGACGGACGAGTGGGACGGCTACAACGTCCTGCAGCGGGAGGCGTCG
AGGGCGGGTGCCTTCGAGGTCGGCTTCGTTACGCCGTCGGCGGCGGTGGCCGAGACGAAGCCCAAGTTCCTGTGG
CTGCTGGGCGCCGATGAGATGGACGAGACGGACATTCCCAAGGACGCCTTCGTCGTCTACCAGGGGCACCACGGC
GACCGCGGCGCGCAGATGGCCGACGTCATCCTGCCGGGCGCCGCCTACACGGAGAAGGCCGGGACGTACGTCAAC
ACGGAAGGGCGAGTGCAGATGACGCGGGCGGCCACGTCGCTGCCCGGCGCCGCCCGGACGGACTGGAAGATCCTG
CGCGCGGCGAGCGAGTTCCTGGGCGCGCCGCTCCCCTACGACGACGTGGCGGCGGTGCGGGACCGCATGGCGGAC
ATCAGCCCGGCGCTGACGGCGTACGACGTGGTCGAGCCCGTCTCGCTGCGGCAGCTGAGCAAGGTGCAGCTGGTG
GACCAGAACAGGGGCGCCAAGGTGGGCGGGTCGCCACTGAAGAAGACGATTGAGAACTTTTACTTTACAGATGTC
ATCTCCCGAAGCTCGCCGACGATGGCGCGCTGTTCGGCAGCCAAGGCCACCGGAGATCCGAGGACGAACTTGATG
GCACCGGGCATGGAAGAGGACAAGCCGATGGGCCAGGTCGCGTACGGAGCTTGA
Transcript >Hirsu2|5467
ATGCTTCGATACTCTCTGGCACGTTCGGCTTGGAGGACGGGCAGGCGGGCCGCCCGTCCCGCGCGGGCCTTTGCG
ACTACAACACGGCGCCAGGCCGAGGTGGAATTGACGATTGACGGGAAGAAGGTCTCCATTGAAGCTGGCTCCGCC
TTGATCCAAGCTTGCGAGAAGGCTGGCGTTACGATTCCCAGATTTTGCTACCATGAGAAGCTCATGATTGCTGGT
AATTGCCGCATGTGCCTGGTCGAGGTGGAGAGGGCACCGAAGCCTGTGGCCTCGTGCGCCTGGCCAGTACAGCCC
GGCATGGTGGTCAAGACCAACTCGCCGCTGACCCACAAGGCTCGCGAGGGCGTCATGGAGTTCCTCCTAGCCAAC
CATCCGCTCGACTGTCCCATCTGCGACCAGGGCGGCGAGTGCGACCTACAAGACCAATCGATGCGCTACGGGGCC
GACCGGGGCCGATTCCACGAGATCGGAGGCAAGCGTGCCGTCGAGGACAAGAACATCGGGCCCTTGATCAAGACG
TCGATGAACCGATGCATCCACTGCACGAGATGCGTGCGGTTCGCCAACGACGTCGCCGGTGCTCCCGAGCTCGGC
TCTACGGGCCGAGGCAACGACCTGCAGATCGGGACGTACCTCGAGAAGAACTTGGACTCGGAGCTCTCCGCCAAC
GTCATCGACCTCTGCCCCGTCGGCGCCCTGACCTCGAAGCCGTATGCCTTCCGGGCCCGTCCCTGGGAACTGAAG
CACACCGAGTCCGTCGACGTCCTCGACGGCCTGGGCTCCAACATCCGCGTCGATTCGAGGGGCCTCGAGGTGATG
CGCGTCCTCCCTCGCCTCAACGACGACGTCAACGAGGAGTGGATCAACGACAAGACCAGATTCGCGTGCGACGGC
CTCAAGACGCAGCGCCTGACGATGCCCCTGGTCCGGCGAGAGGGCAGGTTCGAGCCGGCCGACTGGGAGGAGGCG
CTGGCCGAGGTGGCCCGGGCCTGGGAGCGGAGGAAGCCGCAGGGCAACGAGTTCAAGATCGTTGCCGGCGCCCTG
ACCGAGGTCGAGTCTCTCGTCGTCGCCAAGGACATGGCCAACAAGCTCGGGTCCGACAACCTGGCCCTGGACATG
CCGAGCGGAAGCCAGCCTCTCGCACACGGCGTCGACGTGCGGTCAAACTACCTGTTCAACTCGAGGATCTGGGGC
ATCGAGGAGGCGGACTGCATGCTGATCGTCGGAAGCAATCCGCGGCACGAGGCGGCCGTCCTCAACGCCCGCATC
CGGAAACAGTGGCTCCGCTCCGACCTCGAGATTGGCGTCGTCGGCCAGACGTGGGACTCGACCTTTGAGTTTGAG
CATCTCGGGACCGACCACGCGTCGCTGAAAAAGGCGCTGGCCGGTCCGTTCGGCAAGAAGCTGCAGGCGGCGAAG
AGGCCCATGATCATCGTGGGCTCCGGCGTGACGGACCACGGCGACGCCAAGGCCTTTTACGAGACCATCGGGGCC
TTCGTGGAGAAGAACTCGGCCAACTTCCTGACGGACGAGTGGGACGGCTACAACGTCCTGCAGCGGGAGGCGTCG
AGGGCGGGTGCCTTCGAGGTCGGCTTCGTTACGCCGTCGGCGGCGGTGGCCGAGACGAAGCCCAAGTTCCTGTGG
CTGCTGGGCGCCGATGAGATGGACGAGACGGACATTCCCAAGGACGCCTTCGTCGTCTACCAGGGGCACCACGGC
GACCGCGGCGCGCAGATGGCCGACGTCATCCTGCCGGGCGCCGCCTACACGGAGAAGGCCGGGACGTACGTCAAC
ACGGAAGGGCGAGTGCAGATGACGCGGGCGGCCACGTCGCTGCCCGGCGCCGCCCGGACGGACTGGAAGATCCTG
CGCGCGGCGAGCGAGTTCCTGGGCGCGCCGCTCCCCTACGACGACGTGGCGGCGGTGCGGGACCGCATGGCGGAC
ATCAGCCCGGCGCTGACGGCGTACGACGTGGTCGAGCCCGTCTCGCTGCGGCAGCTGAGCAAGGTGCAGCTGGTG
GACCAGAACAGGGGCGCCAAGGTGGGCGGGTCGCCACTGAAGAAGACGATTGAGAACTTTTACTTTACAGATGTC
ATCTCCCGAAGCTCGCCGACGATGGCGCGCTGTTCGGCAGCCAAGGCCACCGGAGATCCGAGGACGAACTTGATG
GCACCGGGCATGGAAGAGGACAAGCCGATGGGCCAGGTCGCGTACGGAGCTTGA
Gene >Hirsu2|5467
ATGCTTCGATACTCTCTGGCACGTTCGGCTTGGAGGACGGGCAGGCGGGCCGCCCGTCCCGCGCGGGCCTTTGCG
ACTACAACACGGCGCCAGGCCGAGGTGGAATTGACGATTGGTGAGCATCGTCCGACAGCGGCGACGGGGCTCTGG
ACGCGAGCTGACACGAGTTTAGACGGGAAGAAGGTCTCCATTGAAGGTACATCCCACACGGCGAGGCACGAGTGG
CTCTGGACGGCCGTCCTGCTGACACCGAATTAGCTGGCTCCGCCTTGATCCAAGCTTGCGAGAAGGCTGGCGTTA
CGATTCCCAGGTATGACCCTTTCCCCGAGATTCCAGGCACGAGAGAATATTGCTGACCTCGACTGCAGATTTTGC
TACCATGAGTACGAGACCGACTTACCTGTCCCTCTCCAATTCCCCGACGAAGAGACCCTAACGACGATGACCGCA
GGAAGCTCATGATTGCTGGTAATTGCCGCATGTGCCTGGTCGAGGTGGAGAGGGCACCGAAGCCTGTGGCCTCGT
GCGCCTGGCCAGTACAGCCCGGCATGGTGGTCAAGACCAACTCGCCGCTGACCCACAAGGCTCGCGAGGGCGTCA
TGGAGTTCCTCCTAGCCAACCATCCGCTCGACTGTCCCATCTGCGACCAGGGCGGCGAGTGCGACCTACAAGACC
AATCGATGCGCTACGGGGCCGACCGGGGCCGATTCCACGAGATCGGAGGCAAGCGTGCCGTCGAGGACAAGAACA
TCGGGCCCTTGATCAAGACGTCGATGAACCGATGCATCCACTGCACGAGATGCGTGCGGTTCGCCAACGACGTCG
CCGGTGCTCCCGAGCTCGGCTCTACGGGCCGAGGCAACGACCTGCAGATCGGGACGTACCTCGAGAAGAACTTGG
ACTCGGAGCTCTCCGCCAACGTCATCGACCTCTGCCCCGTCGGCGCCCTGACCTCGAAGCCGTATGCCTTCCGGG
CCCGTCCCTGGGAACTGAAGCACACCGAGTCCGTCGACGTCCTCGACGGCCTGGGCTCCAACATCCGCGTCGATT
CGAGGGGCCTCGAGGTGATGCGCGTCCTCCCTCGCCTCAACGACGACGTCAACGAGGAGTGGATCAACGACAAGA
CCAGATTCGCGTGCGACGGCCTCAAGACGCAGCGCCTGACGATGCCCCTGGTCCGGCGAGAGGGCAGGTTCGAGC
CGGCCGACTGGGAGGAGGCGCTGGCCGAGGTGGCCCGGGCCTGGGAGCGGAGGAAGCCGCAGGGCAACGAGTTCA
AGATCGTTGCCGGCGCCCTGACCGAGGTCGAGTCTCTCGTCGTCGCCAAGGACATGGCCAACAAGCTCGGGTCCG
ACAACCTGGCCCTGGACATGCCGAGCGGAAGCCAGCCTCTCGCACACGGCGTCGACGTGCGGTCAAACTACCTGT
TCAACTCGAGGATCTGGGGCATCGAGGAGGCGGACTGCATGCTGATCGTCGGAAGCAATCCGCGGCACGAGGCGG
CCGTCCTCAACGCCCGCATCCGGAAACAGTGGCTCCGCTCCGACCTCGAGATTGGCGTCGTCGGCCAGACGTGGG
ACTCGACCTTTGAGTTTGAGCATCTCGGGACCGACCACGCGTCGCTGAAAAAGGCGCTGGCCGGTCCGTTCGGCA
AGAAGCTGCAGGCGGCGAAGAGGCCCATGATCATCGTGGGCTCCGGCGTGACGGACCACGGCGACGCCAAGGCCT
TTTACGAGACCATCGGGGCCTTCGTGGAGAAGAACTCGGCCAACTTCCTGACGGACGAGTGGGACGGCTACAACG
TCCTGCAGCGGGAGGCGTCGAGGGCGGGTGCCTTCGAGGTCGGCTTCGTTACGCCGTCGGCGGCGGTGGCCGAGA
CGAAGCCCAAGTTCCTGTGGCTGCTGGGCGCCGATGAGATGGACGAGACGGACATTCCCAAGGACGCCTTCGTCG
TCTACCAGGGGCACCACGGCGACCGCGGCGCGCAGATGGCCGACGTCATCCTGCCGGGCGCCGCCTACACGGAGA
AGGCCGGGACGTACGTCAACACGGAAGGGCGAGTGCAGATGACGCGGGCGGCCACGTCGCTGCCCGGCGCCGCCC
GGACGGACTGGAAGATCCTGCGCGCGGCGAGCGAGTTCCTGGGCGCGCCGCTCCCCTACGACGACGTGGCGGCGG
TGCGGGACCGCATGGCGGACATCAGCCCGGCGCTGACGGCGTACGACGTGGTCGAGCCCGTCTCGCTGCGGCAGC
TGAGCAAGGTGCAGCTGGTGGACCAGAACAGGGGCGCCAAGGTGGGCGGGTCGCCACTGAAGAAGACGATTGAGA
ACTTTTACTTTACAGATGTCATCTCCCGAAGGTACGTGACGCTCTCCCTTCCCGTCCCTCCAAAGGACGGGACGG
TCTGCCTGCCGGTCGGTGCTAACTCGCGCCCGCTCCAAGCTCGCCGACGATGGCGCGCTGTTCGGCAGCCAAGGC
CACCGGAGATCCGAGGACGAACTTGATGGCACCGGGCATGGAAGAGGACAAGCCGATGGGCCAGGTCGCGTACGG
AGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail