Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5464
Gene name
LocationContig_2735:130..601
Strand-
Gene length (bp)471
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1088 0.0595 0.9583 0.0423 0.0559 0.0302 0.0525 0.1199 0.0694 0.002

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999614

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2890
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7765
Ophiocordyceps camponoti-rufipedis Ophun1|6973
Ophiocordyceps kimflemingae Ophio5|3432
Ophiocordyceps subramaniannii Hirsu2|4815
Ophiocordyceps subramaniannii Hirsu2|5464 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7643

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5464
MKYAVVFTSATAIVAHALPSSASKPLLPWVGEADRRMPHECGPWGYNDEMCGSLIYCDSIESAPFQRPTDYTSTQ
DCLDAHEPAPTLPWIGSPGVVRPQSCQPGLISIECPVVCGMFNFYSDSLCGTKQYCEAFNKKPKPLGYKNAEACF
DAHDRL*
Coding >Hirsu2|5464
ATGAAGTACGCCGTTGTCTTTACCAGCGCTACCGCCATCGTGGCCCACGCCCTGCCATCGTCGGCCAGCAAGCCG
CTCCTGCCATGGGTGGGCGAAGCAGATCGACGCATGCCGCACGAGTGCGGCCCTTGGGGCTATAATGACGAGATG
TGCGGCAGTCTTATTTATTGCGACTCAATTGAATCGGCTCCATTTCAGCGGCCGACGGATTATACGAGCACTCAG
GATTGCCTCGACGCCCACGAGCCCGCGCCTACCCTGCCCTGGATCGGCAGCCCGGGCGTCGTACGTCCACAGTCG
TGCCAGCCCGGTCTCATTAGCATCGAGTGCCCGGTGGTTTGCGGGATGTTCAACTTCTATTCAGACTCACTTTGC
GGTACAAAGCAATATTGCGAGGCTTTTAATAAGAAGCCTAAACCACTTGGCTATAAGAACGCGGAGGCGTGCTTC
GACGCCCACGACCGTCTTTAG
Transcript >Hirsu2|5464
ATGAAGTACGCCGTTGTCTTTACCAGCGCTACCGCCATCGTGGCCCACGCCCTGCCATCGTCGGCCAGCAAGCCG
CTCCTGCCATGGGTGGGCGAAGCAGATCGACGCATGCCGCACGAGTGCGGCCCTTGGGGCTATAATGACGAGATG
TGCGGCAGTCTTATTTATTGCGACTCAATTGAATCGGCTCCATTTCAGCGGCCGACGGATTATACGAGCACTCAG
GATTGCCTCGACGCCCACGAGCCCGCGCCTACCCTGCCCTGGATCGGCAGCCCGGGCGTCGTACGTCCACAGTCG
TGCCAGCCCGGTCTCATTAGCATCGAGTGCCCGGTGGTTTGCGGGATGTTCAACTTCTATTCAGACTCACTTTGC
GGTACAAAGCAATATTGCGAGGCTTTTAATAAGAAGCCTAAACCACTTGGCTATAAGAACGCGGAGGCGTGCTTC
GACGCCCACGACCGTCTTTAG
Gene >Hirsu2|5464
ATGAAGTACGCCGTTGTCTTTACCAGCGCTACCGCCATCGTGGCCCACGCCCTGCCATCGTCGGCCAGCAAGCCG
CTCCTGCCATGGGTGGGCGAAGCAGATCGACGCATGCCGCACGAGTGCGGCCCTTGGGGCTATAATGACGAGATG
TGCGGCAGTCTTATTTATTGCGACTCAATTGAATCGGCTCCATTTCAGCGGCCGACGGATTATACGAGCACTCAG
GATTGCCTCGACGCCCACGAGCCCGCGCCTACCCTGCCCTGGATCGGCAGCCCGGGCGTCGTACGTCCACAGTCG
TGCCAGCCCGGTCTCATTAGCATCGAGTGCCCGGTGGTTTGCGGGATGTTCAACTTCTATTCAGACTCACTTTGC
GGTACAAAGCAATATTGCGAGGCTTTTAATAAGAAGCCTAAACCACTTGGCTATAAGAACGCGGAGGCGTGCTTC
GACGCCCACGACCGTCTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail