Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5454
Gene name
LocationContig_273:2545..4110
Strand-
Gene length (bp)1565
Transcript length (bp)1341
Coding sequence length (bp)1341
Protein length (aa) 447

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00856 SET SET domain 2.7E-23 40 248
PF09273 Rubis-subs-bind Rubisco LSMT substrate-binding 2.5E-07 333 416

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12504|RKM4_YEAST Ribosomal lysine N-methyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RKM4 PE=1 SV=1 6 442 1.0E-40
sp|Q803K4|SETD6_DANRE N-lysine methyltransferase setd6 OS=Danio rerio GN=setd6 PE=2 SV=1 13 261 2.0E-23
sp|Q5ZK17|SETD6_CHICK N-lysine methyltransferase SETD6 OS=Gallus gallus GN=SETD6 PE=2 SV=2 10 261 2.0E-22
sp|Q9P6L2|RKM4_SCHPO Ribosomal lysine N-methyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set13 PE=3 SV=2 8 274 1.0E-21
sp|Q9CWY3|SETD6_MOUSE N-lysine methyltransferase SETD6 OS=Mus musculus GN=Setd6 PE=1 SV=1 12 416 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12504|RKM4_YEAST Ribosomal lysine N-methyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RKM4 PE=1 SV=1 6 442 1.0E-40
sp|Q803K4|SETD6_DANRE N-lysine methyltransferase setd6 OS=Danio rerio GN=setd6 PE=2 SV=1 13 261 2.0E-23
sp|Q5ZK17|SETD6_CHICK N-lysine methyltransferase SETD6 OS=Gallus gallus GN=SETD6 PE=2 SV=2 10 261 2.0E-22
sp|Q9P6L2|RKM4_SCHPO Ribosomal lysine N-methyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set13 PE=3 SV=2 8 274 1.0E-21
sp|Q9CWY3|SETD6_MOUSE N-lysine methyltransferase SETD6 OS=Mus musculus GN=Setd6 PE=1 SV=1 12 416 2.0E-21
sp|B0VX69|SETD3_CALJA Histone-lysine N-methyltransferase setd3 OS=Callithrix jacchus GN=SETD3 PE=3 SV=2 37 419 3.0E-20
sp|E2RBS6|SETD3_CANLF Histone-lysine N-methyltransferase setd3 OS=Canis lupus familiaris GN=SETD3 PE=3 SV=1 37 419 6.0E-20
sp|A4QNG5|SETD6_XENTR N-lysine methyltransferase setd6 OS=Xenopus tropicalis GN=setd6 PE=2 SV=1 42 261 8.0E-20
sp|E1BI64|SETD6_BOVIN N-lysine methyltransferase SETD6 OS=Bos taurus GN=SETD6 PE=2 SV=1 12 416 8.0E-20
sp|A9X1D0|SETD3_PAPAN Histone-lysine N-methyltransferase setd3 OS=Papio anubis GN=SETD3 PE=3 SV=1 37 419 9.0E-20
sp|Q91WC0|SETD3_MOUSE Histone-lysine N-methyltransferase setd3 OS=Mus musculus GN=Setd3 PE=1 SV=1 37 419 1.0E-19
sp|B1MTJ4|SETD3_CALMO Histone-lysine N-methyltransferase setd3 OS=Callicebus moloch GN=SETD3 PE=3 SV=2 37 419 1.0E-19
sp|Q86TU7|SETD3_HUMAN Histone-lysine N-methyltransferase setd3 OS=Homo sapiens GN=SETD3 PE=1 SV=1 37 419 2.0E-19
sp|Q6INM2|SETD6_XENLA N-lysine methyltransferase setd6 OS=Xenopus laevis GN=setd6 PE=2 SV=1 42 261 2.0E-19
sp|B5FW36|SETD3_OTOGA Histone-lysine N-methyltransferase setd3 OS=Otolemur garnettii GN=SETD3 PE=3 SV=1 37 419 3.0E-19
sp|Q5ZML9|SETD3_CHICK Histone-lysine N-methyltransferase setd3 OS=Gallus gallus GN=SETD3 PE=2 SV=1 40 437 2.0E-18
sp|C1FXW2|SETD3_DASNO Histone-lysine N-methyltransferase setd3 OS=Dasypus novemcinctus GN=SETD3 PE=3 SV=1 37 435 1.0E-17
sp|Q7SXS7|SETD3_DANRE Histone-lysine N-methyltransferase setd3 OS=Danio rerio GN=setd3 PE=1 SV=1 40 422 1.0E-17
sp|B2KI88|SETD3_RHIFE Histone-lysine N-methyltransferase setd3 OS=Rhinolophus ferrumequinum GN=SETD3 PE=3 SV=1 37 419 2.0E-17
sp|C0H8I2|SETD6_SALSA N-lysine methyltransferase setd6 OS=Salmo salar GN=setd6 PE=2 SV=1 11 284 5.0E-17
sp|D3ZSK5|SETD6_RAT N-lysine methyltransferase SETD6 OS=Rattus norvegicus GN=Setd6 PE=3 SV=1 12 424 1.0E-16
sp|B7ZUF3|SETD3_XENTR Histone-lysine N-methyltransferase setd3 OS=Xenopus tropicalis GN=setd3 PE=2 SV=1 40 432 3.0E-16
sp|Q8TBK2|SETD6_HUMAN N-lysine methyltransferase SETD6 OS=Homo sapiens GN=SETD6 PE=1 SV=2 39 424 2.0E-14
sp|P94026|RBCMT_TOBAC Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic OS=Nicotiana tabacum GN=RBCMT PE=2 SV=1 40 418 7.0E-14
sp|Q9XI84|RBCMT_ARATH [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, chloroplastic OS=Arabidopsis thaliana GN=LSMT-L PE=1 SV=1 40 418 1.0E-13
sp|Q43088|RBCMT_PEA Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit N-methyltransferase, chloroplastic OS=Pisum sativum GN=RBCMT PE=1 SV=1 4 423 2.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3285 0.9122 0.1942 0.0133 0.1223 0.0037 0.0537 0.0253 0.0205 0.0269

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3115
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3152
Ophiocordyceps australis map64 (Brazil) OphauB2|1790
Ophiocordyceps camponoti-floridani Ophcf2|03554
Ophiocordyceps camponoti-rufipedis Ophun1|3612
Ophiocordyceps kimflemingae Ophio5|3283
Ophiocordyceps subramaniannii Hirsu2|5454 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5454
MASPSFCQRTEAFLHWFQALPGSTFSDSIQTVDLRSRNAGRGIVATRDIPADTTLFTIPRRSIMSIETSPLRQKL
PHLFESQGDGDDEQALDPWSALILVLVHEYFLGPSSLWEPYMAVLPETFDTPMFWSDEELAELQASPLLSKIGRA
EADDMFRAKLLPIIRSRPMGSTIMAYAFDLENDEDGSDNDDGWVEDREGRSMLGMVPMADLLNADADFNAHVNHG
DDHLTVTSLRPIKAGEEILNYYGPHPNSELLRRYGYVTDKHSRYDVVEIAWSVVEGAAAAHLGLSEDVVEKARAR
TADDDFEDSFVLERDSGDPNPDGTLASSAALHEMPAELRDQLKRFLKAVQKLDGRAVQDKRGRDEAQQAILARSI
LAVESQYPTTGTQDELRLRQEDMSQRRRMAVQVRLGEKRLLEEAKSLLSASSADDLFDGQPASLKRPRRLS*
Coding >Hirsu2|5454
ATGGCCTCACCAAGCTTCTGCCAGAGGACGGAAGCATTCCTCCACTGGTTCCAGGCACTCCCCGGCTCAACGTTT
TCCGACTCCATTCAGACCGTTGATCTGCGCTCTCGAAACGCCGGCCGTGGCATCGTCGCCACTCGGGACATTCCC
GCGGACACCACGCTGTTCACAATACCGCGGAGGTCGATCATGAGCATAGAGACGTCGCCGTTGCGCCAGAAGCTC
CCGCATCTTTTCGAAAGCCAGGGTGATGGAGACGACGAGCAGGCACTGGACCCGTGGAGCGCCCTCATCCTGGTC
TTGGTGCACGAGTATTTCTTGGGACCATCGTCGCTGTGGGAGCCTTACATGGCTGTTCTTCCCGAGACATTCGAT
ACGCCCATGTTCTGGTCGGATGAAGAGCTCGCAGAGCTCCAGGCTAGCCCGCTGCTGTCCAAGATTGGCAGGGCC
GAGGCAGACGACATGTTTCGTGCCAAGCTGCTGCCCATCATCCGCAGCCGGCCGATGGGGAGCACCATCATGGCT
TACGCCTTTGATCTCGAAAACGACGAGGATGGCAGTGACAACGACGACGGCTGGGTGGAGGATCGAGAAGGTAGA
TCCATGCTCGGCATGGTTCCCATGGCCGACCTGTTGAACGCAGACGCCGATTTCAACGCACACGTGAACCACGGC
GACGATCATCTCACCGTGACTTCACTCAGACCGATCAAGGCCGGGGAGGAAATCCTCAACTACTACGGGCCGCAC
CCGAACTCAGAACTCCTCCGCCGTTACGGCTATGTCACTGACAAGCATTCGCGCTACGATGTGGTTGAAATCGCA
TGGAGCGTCGTCGAGGGCGCCGCAGCGGCACACCTGGGCCTTTCCGAGGACGTGGTGGAAAAAGCGCGCGCTCGC
ACCGCCGACGACGACTTCGAAGACAGCTTCGTCCTGGAACGAGACTCGGGTGACCCCAACCCGGATGGCACTCTG
GCCAGCTCGGCTGCTTTGCACGAAATGCCCGCGGAACTGAGAGACCAGCTGAAGCGGTTTCTGAAGGCCGTGCAG
AAGCTGGACGGAAGGGCCGTGCAGGACAAACGAGGGCGGGATGAGGCGCAGCAGGCCATTCTGGCCAGGTCAATA
CTGGCCGTCGAATCTCAGTATCCGACGACCGGGACACAGGATGAGCTGCGCCTCCGTCAAGAAGACATGAGCCAG
CGGAGAAGGATGGCCGTGCAAGTAAGACTGGGCGAGAAACGACTCTTGGAGGAAGCCAAGTCTCTGCTGTCGGCC
TCGTCCGCAGATGACCTGTTCGACGGCCAGCCAGCGTCTCTCAAGAGACCGAGGCGCTTGTCCTGA
Transcript >Hirsu2|5454
ATGGCCTCACCAAGCTTCTGCCAGAGGACGGAAGCATTCCTCCACTGGTTCCAGGCACTCCCCGGCTCAACGTTT
TCCGACTCCATTCAGACCGTTGATCTGCGCTCTCGAAACGCCGGCCGTGGCATCGTCGCCACTCGGGACATTCCC
GCGGACACCACGCTGTTCACAATACCGCGGAGGTCGATCATGAGCATAGAGACGTCGCCGTTGCGCCAGAAGCTC
CCGCATCTTTTCGAAAGCCAGGGTGATGGAGACGACGAGCAGGCACTGGACCCGTGGAGCGCCCTCATCCTGGTC
TTGGTGCACGAGTATTTCTTGGGACCATCGTCGCTGTGGGAGCCTTACATGGCTGTTCTTCCCGAGACATTCGAT
ACGCCCATGTTCTGGTCGGATGAAGAGCTCGCAGAGCTCCAGGCTAGCCCGCTGCTGTCCAAGATTGGCAGGGCC
GAGGCAGACGACATGTTTCGTGCCAAGCTGCTGCCCATCATCCGCAGCCGGCCGATGGGGAGCACCATCATGGCT
TACGCCTTTGATCTCGAAAACGACGAGGATGGCAGTGACAACGACGACGGCTGGGTGGAGGATCGAGAAGGTAGA
TCCATGCTCGGCATGGTTCCCATGGCCGACCTGTTGAACGCAGACGCCGATTTCAACGCACACGTGAACCACGGC
GACGATCATCTCACCGTGACTTCACTCAGACCGATCAAGGCCGGGGAGGAAATCCTCAACTACTACGGGCCGCAC
CCGAACTCAGAACTCCTCCGCCGTTACGGCTATGTCACTGACAAGCATTCGCGCTACGATGTGGTTGAAATCGCA
TGGAGCGTCGTCGAGGGCGCCGCAGCGGCACACCTGGGCCTTTCCGAGGACGTGGTGGAAAAAGCGCGCGCTCGC
ACCGCCGACGACGACTTCGAAGACAGCTTCGTCCTGGAACGAGACTCGGGTGACCCCAACCCGGATGGCACTCTG
GCCAGCTCGGCTGCTTTGCACGAAATGCCCGCGGAACTGAGAGACCAGCTGAAGCGGTTTCTGAAGGCCGTGCAG
AAGCTGGACGGAAGGGCCGTGCAGGACAAACGAGGGCGGGATGAGGCGCAGCAGGCCATTCTGGCCAGGTCAATA
CTGGCCGTCGAATCTCAGTATCCGACGACCGGGACACAGGATGAGCTGCGCCTCCGTCAAGAAGACATGAGCCAG
CGGAGAAGGATGGCCGTGCAAGTAAGACTGGGCGAGAAACGACTCTTGGAGGAAGCCAAGTCTCTGCTGTCGGCC
TCGTCCGCAGATGACCTGTTCGACGGCCAGCCAGCGTCTCTCAAGAGACCGAGGCGCTTGTCCTGA
Gene >Hirsu2|5454
ATGGCCTCACCAAGCTTCTGCCAGAGGACGGAAGCATTCCTCCACTGGTTCCAGGCACTCCCCGGCTCAACGTTT
TCCGACTCCATTCAGACCGTTGATCTGCGCTCTCGAAACGCCGGCCGTGGCATCGGTATGAGCGCTTCGTCGCCG
GCTTACCGCCAACGTTGAATGTGACTGACGTGCCGACAGTCGCCACTCGGGACATTCCCGCGGACACCACGCTGT
TCACAATACCGCGGAGGTCGATCATGAGCATAGAGACGTCGCCGTTGCGCCAGAAGCTCCCGCATCTTTTCGAAA
GCCAGGGTGATGGAGACGACGAGCAGGCACTGGACCCGTGGAGCGCCCTCATCCTGGTCTTGGTGCACGAGTATT
TCTTGGGACCATCGTCGCTGTGGGAGCCTTACATGGCTGTTCTTCCCGAGACATTCGATACGCCCATGTTCTGGT
CGGATGAAGAGCTCGCAGAGCTCCAGGCTAGCCCGCTGCTGTCCAAGATTGGCAGGGCCGAGGCAGACGACATGT
TTCGTGCCAAGCTGCTGCCCATCATCCGCAGCCGGCCGTATGTATTTCGTGGGAGCAGTGAACATAGCGACGAGG
ACCTGTTGCGCCTTGCTCACAGGATGGGGAGCACCATCATGGCTTACGCCTTTGATCTCGAAAACGACGAGGATG
GCAGTGACAACGACGACGGCTGGGTGGAGGATCGAGAAGGTAGATCCATGCTCGGCATGGTTCCCATGGCCGACC
TGTTGAACGCAGACGCCGATTTCAACGTGAGAGACTCTGCTCCCTCTTCAGTCCGGAGCTGACTGTGGCCAGGCA
CACGTGAACCACGGCGACGATCATCTCACCGTGACTTCACTCAGACCGATCAAGGCCGGGGAGGAAATCCTCAAC
TACTACGGGCCGCACCCGAACTCAGAACTCCTCCGCCGTTACGGCTATGTCACTGACAAGCATTCGCGCTACGAT
GTGGTTGAAATCGCATGGAGCGTCGTCGAGGGCGCCGCAGCGGCACACCTGGGCCTTTCCGAGGACGTGGTGGAA
AAAGCGGTAGGTGGCCCGCGGGAGCAGACGGCTGCATTCGCCCATGTCTGCTAACTGCGTCTAAGCGCGCTCGCA
CCGCCGACGACGACTTCGAAGACAGCTTCGTCCTGGAACGAGACTCGGGTGACCCCAACCCGGATGGCACTCTGG
CCAGCTCGGCTGCTTTGCACGAAATGCCCGCGGAACTGAGAGACCAGCTGAAGCGGTTTCTGAAGGCCGTGCAGA
AGCTGGACGGAAGGGCCGTGCAGGACAAACGAGGGCGGGATGAGGCGCAGCAGGCCATTCTGGCCAGGTCAATAC
TGGCCGTCGAATCTCAGTATCCGACGACCGGGACACAGGATGAGCTGCGCCTCCGTCAAGAAGACATGAGCCAGC
GGAGAAGGATGGCCGTGCAAGTAAGACTGGGCGAGAAACGACTCTTGGAGGAAGCCAAGTCTCTGCTGTCGGCCT
CGTCCGCAGATGACCTGTTCGACGGCCAGCCAGCGTCTCTCAAGAGACCGAGGCGCTTGTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail