Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5444
Gene name
LocationContig_2722:264..1366
Strand-
Gene length (bp)1102
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01266 DAO FAD dependent oxidoreductase 3.1E-07 191 220
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.0E-05 194 220
PF01494 FAD_binding_3 FAD binding domain 5.5E-05 189 248

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O65727|ERG11_BRANA Squalene monooxygenase 1,1 OS=Brassica napus GN=SQP1,1 PE=2 SV=1 177 279 1.0E-21
sp|O13306|ERG1_CANGA Squalene monooxygenase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG1 PE=3 SV=2 182 275 2.0E-21
sp|Q14534|ERG1_HUMAN Squalene monooxygenase OS=Homo sapiens GN=SQLE PE=1 SV=3 137 285 5.0E-21
sp|O65404|ERG11_ARATH Squalene epoxidase 5 OS=Arabidopsis thaliana GN=SQE5 PE=2 SV=2 176 281 1.0E-20
sp|O65402|ERG12_ARATH Squalene epoxidase 6 OS=Arabidopsis thaliana GN=SQE6 PE=2 SV=1 173 286 1.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O65727|ERG11_BRANA Squalene monooxygenase 1,1 OS=Brassica napus GN=SQP1,1 PE=2 SV=1 177 279 1.0E-21
sp|O13306|ERG1_CANGA Squalene monooxygenase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG1 PE=3 SV=2 182 275 2.0E-21
sp|Q14534|ERG1_HUMAN Squalene monooxygenase OS=Homo sapiens GN=SQLE PE=1 SV=3 137 285 5.0E-21
sp|O65404|ERG11_ARATH Squalene epoxidase 5 OS=Arabidopsis thaliana GN=SQE5 PE=2 SV=2 176 281 1.0E-20
sp|O65402|ERG12_ARATH Squalene epoxidase 6 OS=Arabidopsis thaliana GN=SQE6 PE=2 SV=1 173 286 1.0E-20
sp|Q92206|ERG1_CANAL Squalene monooxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ERG1 PE=3 SV=1 189 279 2.0E-20
sp|P52019|ERG1_MOUSE Squalene monooxygenase OS=Mus musculus GN=Sqle PE=2 SV=1 137 285 3.0E-20
sp|P32476|ERG1_YEAST Squalene monooxygenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG1 PE=1 SV=2 185 275 1.0E-19
sp|Q75F69|ERG1_ASHGO Squalene monooxygenase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG1 PE=3 SV=1 191 279 6.0E-19
sp|O48651|ERG1_PANGI Squalene monooxygenase OS=Panax ginseng PE=2 SV=1 190 275 8.0E-19
sp|Q9C1W3|ERG1_SCHPO Probable squalene monooxygenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg1 PE=3 SV=1 201 281 9.0E-19
sp|O81000|ERG15_ARATH Squalene epoxidase 2, mitochondrial OS=Arabidopsis thaliana GN=SQE2 PE=1 SV=1 190 283 4.0E-18
sp|O65726|ERG12_BRANA Squalene monooxygenase 1,2 OS=Brassica napus GN=SQP1,2 PE=2 SV=1 191 280 5.0E-18
sp|P52020|ERG1_RAT Squalene monooxygenase OS=Rattus norvegicus GN=Sqle PE=2 SV=1 137 285 5.0E-18
sp|Q9SM02|ERG14_ARATH Squalene epoxidase 1 OS=Arabidopsis thaliana GN=SQE1 PE=1 SV=1 171 275 2.0E-17
sp|O65403|ERG13_ARATH Squalene epoxidase 4 OS=Arabidopsis thaliana GN=SQE4 PE=2 SV=1 177 279 2.0E-17
sp|Q8VYH2|ERG16_ARATH Squalene epoxidase 3 OS=Arabidopsis thaliana GN=SQE3 PE=1 SV=1 204 283 2.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0071949 FAD binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0050662 coenzyme binding No
GO:0008152 metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0008150 biological_process No
GO:0048037 cofactor binding No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0043168 anion binding No
GO:0003824 catalytic activity No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 61 83 22
2 108 127 19
3 192 209 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5444
MCAPAIGRRLATSGAGPGRGADLAMSSAVARLRPSAIPLPGPSWPELSLLHRCAARHSLEIGIGISFFFLFGFEC
SELLAFQAGASCQLPPLAAWPGLPFSSRLTTLHTRHRLVVFIALLVLVFFVLSPRKREAVQPLPPAFLSRSPRID
PSSSLAMAAKAKSNAGAGADAPLSSAQASARTRRDTYHEADVVVVGAGIFGCAIAFALANQGRSVLLLERWMKEP
DRIVGELLQPGGVAALKKLGLGHCLDGIDAIPCLGYNVLYHGQESLVPYPAVDDDGQVRSPC*
Coding >Hirsu2|5444
ATGTGCGCGCCCGCCATTGGCCGCCGCCTCGCCACAAGTGGCGCCGGCCCGGGTCGAGGCGCAGACCTGGCGATG
TCGTCGGCCGTCGCTCGCCTTCGCCCCTCTGCCATCCCACTCCCGGGTCCATCGTGGCCTGAGTTGAGCCTCCTG
CATCGCTGCGCTGCGAGACATTCGCTCGAAATCGGGATTGGCATCTCTTTTTTTTTTTTGTTTGGCTTTGAGTGC
TCTGAACTTCTGGCATTCCAGGCTGGAGCGTCTTGCCAGTTGCCACCCTTGGCTGCCTGGCCTGGCCTCCCTTTT
TCGTCTCGATTGACGACGCTTCACACTCGACATCGCCTCGTCGTCTTCATCGCCCTCCTCGTCCTCGTCTTCTTC
GTCCTCTCCCCTCGGAAAAGAGAAGCAGTCCAGCCTTTGCCACCCGCCTTTCTCTCTCGTTCGCCTCGGATCGAT
CCGTCATCCTCCCTCGCCATGGCAGCCAAGGCCAAGAGTAACGCTGGTGCCGGCGCCGACGCGCCTCTCTCGTCG
GCCCAGGCTTCGGCTCGCACCCGCCGCGACACATACCACGAGGCCGACGTCGTCGTCGTCGGCGCCGGCATCTTC
GGCTGCGCCATCGCCTTCGCCCTCGCCAACCAGGGCCGCTCCGTCCTGCTGCTGGAGCGGTGGATGAAGGAGCCG
GACCGGATCGTGGGCGAGCTGCTGCAGCCCGGCGGCGTGGCGGCGCTCAAGAAGCTGGGCCTGGGCCACTGCCTC
GACGGCATCGACGCCATCCCCTGCCTCGGCTACAACGTCCTCTACCACGGCCAGGAGTCGCTCGTGCCGTACCCG
GCCGTCGACGACGACGGCCAGGTGCGCTCCCCCTGCTGA
Transcript >Hirsu2|5444
ATGTGCGCGCCCGCCATTGGCCGCCGCCTCGCCACAAGTGGCGCCGGCCCGGGTCGAGGCGCAGACCTGGCGATG
TCGTCGGCCGTCGCTCGCCTTCGCCCCTCTGCCATCCCACTCCCGGGTCCATCGTGGCCTGAGTTGAGCCTCCTG
CATCGCTGCGCTGCGAGACATTCGCTCGAAATCGGGATTGGCATCTCTTTTTTTTTTTTGTTTGGCTTTGAGTGC
TCTGAACTTCTGGCATTCCAGGCTGGAGCGTCTTGCCAGTTGCCACCCTTGGCTGCCTGGCCTGGCCTCCCTTTT
TCGTCTCGATTGACGACGCTTCACACTCGACATCGCCTCGTCGTCTTCATCGCCCTCCTCGTCCTCGTCTTCTTC
GTCCTCTCCCCTCGGAAAAGAGAAGCAGTCCAGCCTTTGCCACCCGCCTTTCTCTCTCGTTCGCCTCGGATCGAT
CCGTCATCCTCCCTCGCCATGGCAGCCAAGGCCAAGAGTAACGCTGGTGCCGGCGCCGACGCGCCTCTCTCGTCG
GCCCAGGCTTCGGCTCGCACCCGCCGCGACACATACCACGAGGCCGACGTCGTCGTCGTCGGCGCCGGCATCTTC
GGCTGCGCCATCGCCTTCGCCCTCGCCAACCAGGGCCGCTCCGTCCTGCTGCTGGAGCGGTGGATGAAGGAGCCG
GACCGGATCGTGGGCGAGCTGCTGCAGCCCGGCGGCGTGGCGGCGCTCAAGAAGCTGGGCCTGGGCCACTGCCTC
GACGGCATCGACGCCATCCCCTGCCTCGGCTACAACGTCCTCTACCACGGCCAGGAGTCGCTCGTGCCGTACCCG
GCCGTCGACGACGACGGCCAGGTGCGCTCCCCCTGCTGA
Gene >Hirsu2|5444
ATGTGCGCGCCCGCCATTGGCCGCCGCCTCGCCACAAGTGGCGCCGGCCCGGGTCGAGGCGCAGACCTGGCGATG
TCGTCGGCCGTCGCTCGCCTTCGCCCCTCTGCCATCCCACTCCCGGGTCCATCGTGGCCTGAGTTGAGCCTCCTG
CATCGCTGCGCTGCGAGACATTCGCTCGAAATCGGGATTGGCATCTCTTTTTTTTTTTTGTTTGGCTTTGAGTGC
TCTGAACTTCTGGCATTCCAGGCTGGAGCGTCTTGCCAGTTGCCACCCTTGGCTGCCTGGCCTGGCCTCCCTTTT
TCGTCTCGATTGACGACGCTTCACACTCGACATCGCCTCGTCGTCTTCATCGCCCTCCTCGTCCTCGTCTTCTTC
GTCCTCTCCCCTCGGAAAAGAGAAGCAGTCCAGCCTTTGCCACCCGCCTTTCTCTCTCGTTCGCCTCGGATCGAT
CCGTCATCCTCCCTCGCCATGGCAGCCAAGGCCAAGAGTAACGCTGGTGCCGGCGCCGACGCGCCTCTCTCGTCG
GCCCAGGCTTCGGCTCGCACCCGCCGCGACACATACCACGAGGCCGACGTCGTCGTCGTCGGCGCCGGCATCTTC
GGCTGCGCCATCGCCTTCGCCCTCGCCAACCAGGGCCGCTCCGTCCTGCTGCTGGAGCGGTGGATGAAGGAGCCG
GACCGGATCGTGGGCGAGCTGCTGCAGCCCGGCGGCGTGGCGGCGCTCAAGAAGCTGGGCCTGGGCCACTGCCTC
GACGGCATCGACGCCATCCCCTGCCTCGGCTACAACGTCCTCTACCACGGCCAGGAGTCGCTCGTGCCGTACCCG
GCCGTCGACGACGACGGCCAGGTGCGCTCCCCCTGGTCCGGCGGCTCCGGCGCCGACGCCGACGCCAAGCGGCCC
CAGGGCCGGAGCTTCCACCACGGCCGCTTCGTCATGCAGCTGCGCCGGGCCTGCATGGCCCACGCCAACATCAGC
CTGGTCGAGACCGAGGCCGTCAAGACGATCCGCGGCGAGCACTCGGCCCAGGTGCTGGGCGTCGAGGCGCGCACC
GCCGACGCCGACACGGGCGCCAAGCGCAGCGACTACTACTTCGGCCAGCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail