Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5433
Gene name
LocationContig_272:6953..7817
Strand+
Gene length (bp)864
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09439 SRPRB Signal recognition particle receptor beta subunit 1.5E-28 47 255
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.0E-07 49 167

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36057|SRPB_YEAST Signal recognition particle receptor subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRP102 PE=1 SV=1 18 286 3.0E-13
sp|P47758|SRPRB_MOUSE Signal recognition particle receptor subunit beta OS=Mus musculus GN=Srprb PE=1 SV=1 49 284 4.0E-11
sp|Q9Y5M8|SRPRB_HUMAN Signal recognition particle receptor subunit beta OS=Homo sapiens GN=SRPRB PE=1 SV=3 49 284 6.0E-11
sp|Q4FZX7|SRPRB_RAT Signal recognition particle receptor subunit beta OS=Rattus norvegicus GN=Srprb PE=2 SV=1 49 284 1.0E-10
sp|O13950|SRPB_SCHPO Signal recognition particle receptor subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=srp102 PE=3 SV=1 25 282 3.0E-09

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0017076 purine nucleotide binding No
GO:0001882 nucleoside binding No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0019001 guanyl nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0032549 ribonucleoside binding No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0001883 purine nucleoside binding No
GO:0032550 purine ribonucleoside binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 15 37 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5433
MASFADIVEALMTPSIPLVLVGILVILGAPVLLHLILASSSTYTVPPVVVVVGPENAGKTALATLLERGTRPALT
HTSQVTHSVELNASTDSASKQSFRNHDDTTGTHTKFLLVDTPGHAKLRNVAMGRLGRAEKLRAVVFMVDASALGE
QDTLAPTAAYLYDVLLHLQKKAAGDKAKAKAPVPLLVAANKTDLFTALPATMVKSHLEAELSRIRASKSKGLLDS
GVGIDDVGSEDQDSWLGEYGSAKFVFDQMREFGIEVEVVGGSVMADEADVDKWWWWMAQRVS*
Coding >Hirsu2|5433
ATGGCCAGCTTCGCCGACATCGTCGAGGCGCTCATGACGCCGTCGATCCCCCTCGTCCTCGTCGGCATCCTCGTC
ATCCTTGGCGCGCCCGTGCTCCTGCACCTCATCCTCGCCTCGTCGTCGACCTACACCGTGCCGCCCGTCGTCGTT
GTCGTCGGCCCCGAAAACGCCGGCAAGACGGCCCTCGCCACCCTCCTGGAGCGCGGCACCCGGCCCGCCCTGACG
CACACGTCGCAGGTCACGCACTCGGTCGAGCTCAACGCGTCCACCGACTCGGCCTCGAAGCAGTCCTTCCGCAAC
CATGACGACACCACCGGCACGCACACCAAGTTCCTCCTCGTCGACACGCCCGGCCACGCCAAGCTGCGCAACGTC
GCCATGGGCCGCCTGGGCCGCGCCGAGAAGCTCAGGGCCGTCGTGTTCATGGTTGACGCCTCGGCCCTCGGCGAG
CAGGATACGCTGGCACCGACGGCCGCCTACCTCTACGACGTGCTGCTGCACCTGCAGAAGAAGGCTGCCGGCGAC
AAGGCCAAGGCCAAGGCACCCGTCCCTCTGCTCGTTGCCGCCAACAAGACGGATCTTTTCACGGCCCTTCCCGCG
ACCATGGTTAAGTCTCACCTGGAGGCTGAGCTCAGCCGGATCCGCGCGTCCAAGAGCAAGGGTCTGCTAGACTCT
GGCGTCGGCATAGACGACGTCGGCTCCGAGGACCAAGACTCATGGCTGGGCGAATACGGGTCTGCAAAGTTCGTG
TTTGATCAGATGCGCGAGTTCGGCATCGAGGTCGAGGTTGTGGGCGGCAGCGTCATGGCCGACGAGGCTGACGTG
GACAAGTGGTGGTGGTGGATGGCGCAAAGAGTCTCGTAA
Transcript >Hirsu2|5433
ATGGCCAGCTTCGCCGACATCGTCGAGGCGCTCATGACGCCGTCGATCCCCCTCGTCCTCGTCGGCATCCTCGTC
ATCCTTGGCGCGCCCGTGCTCCTGCACCTCATCCTCGCCTCGTCGTCGACCTACACCGTGCCGCCCGTCGTCGTT
GTCGTCGGCCCCGAAAACGCCGGCAAGACGGCCCTCGCCACCCTCCTGGAGCGCGGCACCCGGCCCGCCCTGACG
CACACGTCGCAGGTCACGCACTCGGTCGAGCTCAACGCGTCCACCGACTCGGCCTCGAAGCAGTCCTTCCGCAAC
CATGACGACACCACCGGCACGCACACCAAGTTCCTCCTCGTCGACACGCCCGGCCACGCCAAGCTGCGCAACGTC
GCCATGGGCCGCCTGGGCCGCGCCGAGAAGCTCAGGGCCGTCGTGTTCATGGTTGACGCCTCGGCCCTCGGCGAG
CAGGATACGCTGGCACCGACGGCCGCCTACCTCTACGACGTGCTGCTGCACCTGCAGAAGAAGGCTGCCGGCGAC
AAGGCCAAGGCCAAGGCACCCGTCCCTCTGCTCGTTGCCGCCAACAAGACGGATCTTTTCACGGCCCTTCCCGCG
ACCATGGTTAAGTCTCACCTGGAGGCTGAGCTCAGCCGGATCCGCGCGTCCAAGAGCAAGGGTCTGCTAGACTCT
GGCGTCGGCATAGACGACGTCGGCTCCGAGGACCAAGACTCATGGCTGGGCGAATACGGGTCTGCAAAGTTCGTG
TTTGATCAGATGCGCGAGTTCGGCATCGAGGTCGAGGTTGTGGGCGGCAGCGTCATGGCCGACGAGGCTGACGTG
GACAAGTGGTGGTGGTGGATGGCGCAAAGAGTCTCGTAA
Gene >Hirsu2|5433
ATGGCCAGCTTCGCCGACATCGTCGAGGCGCTCATGACGCCGTCGATCCCCCTCGTCCTCGTCGGCATCCTCGTC
ATCCTTGGCGCGCCCGTGCTCCTGCACCTCATCCTCGCCTCGTCGTCGACCTACACCGTGCCGCCCGTCGTCGTT
GTCGTCGGCCCCGAAAACGCCGGCAAGACGGCCCTCGCCACCCTCCTGGAGCGCGGCACCCGGCCCGCCCTGACG
CACACGTCGCAGGTCACGCACTCGGTCGAGCTCAACGCGTCCACCGACTCGGCCTCGAAGCAGTCCTTCCGCAAC
CATGACGACACCACCGGCACGCACACCAAGTTCCTCCTCGTCGACACGCCCGGCCACGCCAAGCTGCGCAACGTC
GCCATGGGCCGCCTGGGCCGCGCCGAGAAGCTCAGGGCCGTCGTGTTCATGGTTGACGCCTCGGCCCTCGGCGAG
CAGGATACGCTGGCACCGACGGCCGCCTACCTCTACGACGTGCTGCTGCACCTGCAGAAGAAGGCTGCCGGCGAC
AAGGCCAAGGCCAAGGCACCCGTCCCTCTGCTCGTTGCCGCCAACAAGACGGATCTTTTCACGGCCCTTCCCGCG
ACCATGGTTAAGTCTCACCTGGAGGCTGAGCTCAGCCGGATCCGCGCGTCCAAGAGCAAGGGTCTGCTAGACTCT
GGCGTCGGCATAGACGACGTCGGCTCCGAGGACCAAGACTCATGGCTGGGCGAATACGGGTCTGCAAAGTTCGTG
TTTGATCAGATGCGCGAGTTCGGCATCGAGGTCGAGGTTGTGGGCGGCAGCGTCATGGCCGACGAGGCTGACGTG
GACAAGTGGTGGTGGTGGATGGCGCAAAGAGTCTCGTAA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail