Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5429
Gene name
LocationContig_2719:232..1368
Strand-
Gene length (bp)1136
Transcript length (bp)1080
Coding sequence length (bp)1080
Protein length (aa) 360

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00226 DnaJ DnaJ domain 7.2E-22 20 82
PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding 2.5E-07 316 339
PF12874 zf-met Zinc-finger of C2H2 type 1.8E-05 317 339

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53863|JJJ1_YEAST J protein JJJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JJJ1 PE=1 SV=1 17 343 7.0E-50
sp|Q6PGY5|DJC21_DANRE DnaJ homolog subfamily C member 21 OS=Danio rerio GN=dnajc21 PE=2 SV=1 19 349 3.0E-46
sp|Q0II91|DJC21_BOVIN DnaJ homolog subfamily C member 21 OS=Bos taurus GN=DNAJC21 PE=2 SV=2 19 349 5.0E-44
sp|Q5F1R6|DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens GN=DNAJC21 PE=1 SV=2 19 349 8.0E-43
sp|O14213|MU185_SCHPO Meiotically up-regulated gene 185 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug185 PE=1 SV=1 21 348 7.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53863|JJJ1_YEAST J protein JJJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=JJJ1 PE=1 SV=1 17 343 7.0E-50
sp|Q6PGY5|DJC21_DANRE DnaJ homolog subfamily C member 21 OS=Danio rerio GN=dnajc21 PE=2 SV=1 19 349 3.0E-46
sp|Q0II91|DJC21_BOVIN DnaJ homolog subfamily C member 21 OS=Bos taurus GN=DNAJC21 PE=2 SV=2 19 349 5.0E-44
sp|Q5F1R6|DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens GN=DNAJC21 PE=1 SV=2 19 349 8.0E-43
sp|O14213|MU185_SCHPO Meiotically up-regulated gene 185 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug185 PE=1 SV=1 21 348 7.0E-29
sp|Q7UM96|DNAJ_RHOBA Chaperone protein DnaJ OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=dnaJ PE=3 SV=1 15 92 2.0E-14
sp|Q626I7|DNJ20_CAEBR DnaJ homolog dnj-20 OS=Caenorhabditis briggsae GN=dnj-20 PE=3 SV=1 20 84 4.0E-13
sp|P39101|CAJ1_YEAST Protein CAJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAJ1 PE=1 SV=1 20 116 5.0E-13
sp|Q8MPX3|DNJ20_CAEEL DnaJ homolog dnj-20 OS=Caenorhabditis elegans GN=dnj-20 PE=3 SV=2 11 84 1.0E-12
sp|P25686|DNJB2_HUMAN DnaJ homolog subfamily B member 2 OS=Homo sapiens GN=DNAJB2 PE=1 SV=3 18 93 1.0E-12
sp|Q9QYI5|DNJB2_MOUSE DnaJ homolog subfamily B member 2 OS=Mus musculus GN=Dnajb2 PE=1 SV=2 18 93 1.0E-12
sp|Q8NHS0|DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens GN=DNAJB8 PE=1 SV=1 18 116 2.0E-12
sp|Q9QYI7|DNJB8_MOUSE DnaJ homolog subfamily B member 8 OS=Mus musculus GN=Dnajb8 PE=2 SV=1 18 82 2.0E-12
sp|Q99KV1|DJB11_MOUSE DnaJ homolog subfamily B member 11 OS=Mus musculus GN=Dnajb11 PE=1 SV=1 20 97 2.0E-12
sp|Q5RAJ6|DJB11_PONAB DnaJ homolog subfamily B member 11 OS=Pongo abelii GN=DNAJB11 PE=2 SV=1 20 97 3.0E-12
sp|Q9UBS4|DJB11_HUMAN DnaJ homolog subfamily B member 11 OS=Homo sapiens GN=DNAJB11 PE=1 SV=1 20 97 3.0E-12
sp|Q6TUG0|DJB11_RAT DnaJ homolog subfamily B member 11 OS=Rattus norvegicus GN=Dnajb11 PE=2 SV=1 20 97 3.0E-12
sp|Q52702|DNAJ_RHOCA Chaperone protein DnaJ OS=Rhodobacter capsulatus GN=dnaJ PE=3 SV=1 20 84 3.0E-12
sp|Q5FGQ8|DNAJ_EHRRG Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Gardel) GN=dnaJ PE=3 SV=1 16 93 3.0E-12
sp|Q5HCG4|DNAJ_EHRRW Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaJ PE=3 SV=1 16 93 3.0E-12
sp|Q5FWN8|DNJ6A_XENLA DnaJ homolog subfamily B member 6-A OS=Xenopus laevis GN=dnajb6-a PE=2 SV=1 20 116 3.0E-12
sp|A4IX29|DNAJ_FRATW Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=dnaJ PE=3 SV=1 19 82 3.0E-12
sp|Q5NFG8|DNAJ_FRATT Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=dnaJ PE=3 SV=1 19 82 4.0E-12
sp|Q14GX0|DNAJ_FRAT1 Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=dnaJ PE=3 SV=1 19 82 4.0E-12
sp|Q6P642|DNJB6_XENTR DnaJ homolog subfamily B member 6 OS=Xenopus tropicalis GN=dnajb6 PE=2 SV=1 20 104 4.0E-12
sp|Q2VYT0|DNAJ_MAGSA Chaperone protein DnaJ OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dnaJ PE=3 SV=1 20 82 4.0E-12
sp|P9WNV7|DNAJ2_MYCTU Chaperone protein DnaJ 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dnaJ2 PE=1 SV=1 20 88 4.0E-12
sp|P9WNV6|DNAJ2_MYCTO Chaperone protein DnaJ 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dnaJ2 PE=3 SV=1 20 88 4.0E-12
sp|P63967|DNAJ2_MYCBO Chaperone protein DnaJ 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dnaJ2 PE=3 SV=1 20 88 4.0E-12
sp|Q2S030|DNAJ_SALRD Chaperone protein DnaJ OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaJ PE=3 SV=1 20 82 5.0E-12
sp|P25491|MAS5_YEAST Mitochondrial protein import protein MAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDJ1 PE=1 SV=1 20 82 5.0E-12
sp|Q3ZBA6|DJB11_BOVIN DnaJ homolog subfamily B member 11 OS=Bos taurus GN=DNAJB11 PE=2 SV=1 20 97 5.0E-12
sp|P81999|DJB11_CANLF DnaJ homolog subfamily B member 11 OS=Canis lupus familiaris GN=DNAJB11 PE=1 SV=2 20 97 6.0E-12
sp|Q49762|DNAJ2_MYCLE Chaperone protein DnaJ 2 OS=Mycobacterium leprae (strain TN) GN=dnaJ2 PE=3 SV=1 20 96 6.0E-12
sp|Q7MN84|DNAJ_VIBVY Chaperone protein DnaJ OS=Vibrio vulnificus (strain YJ016) GN=dnaJ PE=3 SV=2 20 84 7.0E-12
sp|Q8DF67|DNAJ_VIBVU Chaperone protein DnaJ OS=Vibrio vulnificus (strain CMCP6) GN=dnaJ PE=3 SV=1 20 84 7.0E-12
sp|B2FMY6|DNAJ_STRMK Chaperone protein DnaJ OS=Stenotrophomonas maltophilia (strain K279a) GN=dnaJ PE=3 SV=1 20 84 7.0E-12
sp|Q10209|YAY1_SCHPO Uncharacterized J domain-containing protein C4H3.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.01 PE=1 SV=1 14 82 8.0E-12
sp|C6BYN5|DNAJ_DESAD Chaperone protein DnaJ OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dnaJ PE=3 SV=1 16 82 9.0E-12
sp|A7MWW1|DNAJ_VIBCB Chaperone protein DnaJ OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dnaJ PE=3 SV=1 20 84 9.0E-12
sp|Q54ED3|DNJA1_DICDI DnaJ homolog subfamily A member 1 homolog OS=Dictyostelium discoideum GN=dnaja1 PE=3 SV=1 20 93 9.0E-12
sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 20 82 1.0E-11
sp|Q2GI75|DNAJ_EHRCR Chaperone protein DnaJ OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dnaJ PE=3 SV=1 16 84 1.0E-11
sp|Q9JMC3|DNJA4_MOUSE DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=1 SV=1 20 83 1.0E-11
sp|B6IVA5|DNAJ_RHOCS Chaperone protein DnaJ OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dnaJ PE=3 SV=1 20 82 1.0E-11
sp|Q0III6|DNJB6_BOVIN DnaJ homolog subfamily B member 6 OS=Bos taurus GN=DNAJB6 PE=2 SV=1 20 84 1.0E-11
sp|B0TYF3|DNAJ_FRAP2 Chaperone protein DnaJ OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=dnaJ PE=3 SV=1 19 82 1.0E-11
sp|D2H417|DNJ5B_AILME DnaJ homolog subfamily C member 5B OS=Ailuropoda melanoleuca GN=DNAJC5B PE=3 SV=1 1 84 1.0E-11
sp|Q892R1|DNAJ_CLOTE Chaperone protein DnaJ OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaJ PE=3 SV=1 20 93 1.0E-11
sp|Q8WW22|DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1 20 83 2.0E-11
sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 20 119 2.0E-11
sp|A8LQ63|DNAJ_DINSH Chaperone protein DnaJ OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=dnaJ PE=3 SV=1 20 84 2.0E-11
sp|Q182E7|DNAJ_PEPD6 Chaperone protein DnaJ OS=Peptoclostridium difficile (strain 630) GN=dnaJ PE=3 SV=1 15 82 2.0E-11
sp|P48207|DNAJ_FRATU Chaperone protein DnaJ OS=Francisella tularensis GN=dnaJ PE=3 SV=1 19 82 2.0E-11
sp|Q2A327|DNAJ_FRATH Chaperone protein DnaJ OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dnaJ PE=3 SV=1 19 82 2.0E-11
sp|Q9UF47|DNJ5B_HUMAN DnaJ homolog subfamily C member 5B OS=Homo sapiens GN=DNAJC5B PE=1 SV=2 1 84 2.0E-11
sp|Q7VQL3|DNAJ_BLOFL Chaperone protein DnaJ OS=Blochmannia floridanus GN=dnaJ PE=3 SV=1 16 88 2.0E-11
sp|B2RLJ0|DNAJ_PORG3 Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaJ PE=3 SV=1 20 82 2.0E-11
sp|P25294|SIS1_YEAST Protein SIS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SIS1 PE=1 SV=1 20 84 2.0E-11
sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaJ PE=3 SV=1 20 84 2.0E-11
sp|Q0AKB3|DNAJ_MARMM Chaperone protein DnaJ OS=Maricaulis maris (strain MCS10) GN=dnaJ PE=3 SV=1 20 82 2.0E-11
sp|Q5YZX0|DNAJ1_NOCFA Chaperone protein DnaJ 1 OS=Nocardia farcinica (strain IFM 10152) GN=dnaJ1 PE=3 SV=1 20 88 2.0E-11
sp|O60884|DNJA2_HUMAN DnaJ homolog subfamily A member 2 OS=Homo sapiens GN=DNAJA2 PE=1 SV=1 10 84 2.0E-11
sp|O87385|DNAJ_VIBHA Chaperone protein DnaJ OS=Vibrio harveyi GN=dnaJ PE=3 SV=1 20 84 3.0E-11
sp|Q9QYJ0|DNJA2_MOUSE DnaJ homolog subfamily A member 2 OS=Mus musculus GN=Dnaja2 PE=1 SV=1 10 84 3.0E-11
sp|O35824|DNJA2_RAT DnaJ homolog subfamily A member 2 OS=Rattus norvegicus GN=Dnaja2 PE=1 SV=1 10 84 3.0E-11
sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 20 84 3.0E-11
sp|B4SSQ7|DNAJ_STRM5 Chaperone protein DnaJ OS=Stenotrophomonas maltophilia (strain R551-3) GN=dnaJ PE=3 SV=1 20 84 3.0E-11
sp|Q15UD2|DNAJ_PSEA6 Chaperone protein DnaJ OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dnaJ PE=3 SV=1 20 89 3.0E-11
sp|Q2HJ94|DNJA2_BOVIN DnaJ homolog subfamily A member 2 OS=Bos taurus GN=DNAJA2 PE=2 SV=1 10 84 3.0E-11
sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 20 84 3.0E-11
sp|Q9QYI8|DNJB7_MOUSE DnaJ homolog subfamily B member 7 OS=Mus musculus GN=Dnajb7 PE=2 SV=2 20 98 3.0E-11
sp|Q9Z9E9|DNAJ_CHLPN Chaperone protein DnaJ OS=Chlamydia pneumoniae GN=dnaJ PE=3 SV=1 20 82 3.0E-11
sp|Q9RUG2|DNAJ_DEIRA Chaperone protein DnaJ OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=dnaJ PE=3 SV=2 20 82 3.0E-11
sp|B6EKA0|DNAJ_ALISL Chaperone protein DnaJ OS=Aliivibrio salmonicida (strain LFI1238) GN=dnaJ PE=3 SV=1 20 84 3.0E-11
sp|Q5E3A8|DNAJ_VIBF1 Chaperone protein DnaJ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaJ PE=3 SV=1 20 84 4.0E-11
sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 15 137 4.0E-11
sp|O54946|DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus GN=Dnajb6 PE=1 SV=4 20 84 4.0E-11
sp|Q6AYU3|DNJB6_RAT DnaJ homolog subfamily B member 6 OS=Rattus norvegicus GN=Dnajb6 PE=1 SV=1 20 84 4.0E-11
sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallus gallus GN=DNAJB6 PE=2 SV=1 20 82 4.0E-11
sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=1 SV=1 20 82 4.0E-11
sp|Q8A8C3|DNAJ_BACTN Chaperone protein DnaJ OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=dnaJ PE=3 SV=1 20 90 4.0E-11
sp|A6T225|DNAJ_JANMA Chaperone protein DnaJ OS=Janthinobacterium sp. (strain Marseille) GN=dnaJ PE=3 SV=1 20 89 5.0E-11
sp|A3DF24|DNAJ_CLOTH Chaperone protein DnaJ OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaJ PE=3 SV=1 20 82 5.0E-11
sp|Q73XZ6|DNAJ1_MYCPA Chaperone protein DnaJ 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=dnaJ1 PE=3 SV=1 20 88 6.0E-11
sp|Q5XGU5|DNJ6B_XENLA DnaJ homolog subfamily B member 6-B OS=Xenopus laevis GN=dnajb6-b PE=2 SV=1 20 84 6.0E-11
sp|B1WVR2|DNAJ_CYAA5 Chaperone protein DnaJ OS=Cyanothece sp. (strain ATCC 51142) GN=dnaJ PE=3 SV=1 20 93 6.0E-11
sp|Q7NXI1|DNAJ_CHRVO Chaperone protein DnaJ OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaJ PE=3 SV=1 20 82 7.0E-11
sp|Q29455|DNJC5_BOVIN DnaJ homolog subfamily C member 5 OS=Bos taurus GN=DNAJC5 PE=2 SV=1 6 84 7.0E-11
sp|P60905|DNJC5_RAT DnaJ homolog subfamily C member 5 OS=Rattus norvegicus GN=Dnajc5 PE=1 SV=1 6 84 7.0E-11
sp|P60904|DNJC5_MOUSE DnaJ homolog subfamily C member 5 OS=Mus musculus GN=Dnajc5 PE=1 SV=1 6 84 7.0E-11
sp|Q9H3Z4|DNJC5_HUMAN DnaJ homolog subfamily C member 5 OS=Homo sapiens GN=DNAJC5 PE=1 SV=1 6 84 7.0E-11
sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens GN=DNAJA1 PE=1 SV=2 20 82 8.0E-11
sp|Q5E954|DNJA1_BOVIN DnaJ homolog subfamily A member 1 OS=Bos taurus GN=DNAJA1 PE=2 SV=2 20 82 8.0E-11
sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 20 82 8.0E-11
sp|Q95JF4|DNAJ1_CHLAE DnaJ homolog subfamily A member 1 OS=Chlorocebus aethiops GN=DNAJA1 PE=2 SV=1 20 82 8.0E-11
sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 20 82 8.0E-11
sp|Q5NVI9|DNJA1_PONAB DnaJ homolog subfamily A member 1 OS=Pongo abelii GN=DNAJA1 PE=2 SV=1 20 82 8.0E-11
sp|C1DD87|DNAJ_LARHH Chaperone protein DnaJ OS=Laribacter hongkongensis (strain HLHK9) GN=dnaJ PE=3 SV=1 20 89 9.0E-11
sp|A4W6D6|DNAJ_ENT38 Chaperone protein DnaJ OS=Enterobacter sp. (strain 638) GN=dnaJ PE=3 SV=1 20 87 9.0E-11
sp|Q8DKR7|DNAJ_THEEB Chaperone protein DnaJ OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaJ PE=3 SV=2 20 93 9.0E-11
sp|A5N6M3|DNAJ_CLOK5 Chaperone protein DnaJ OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaJ PE=3 SV=1 20 82 1.0E-10
sp|Q6LUA6|DNAJ_PHOPR Chaperone protein DnaJ OS=Photobacterium profundum GN=dnaJ PE=3 SV=1 20 84 1.0E-10
sp|P78004|DNAJ_MYCPN Chaperone protein DnaJ OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaJ PE=3 SV=1 13 82 1.0E-10
sp|Q05646|DNAJ_ERYRH Chaperone protein DnaJ OS=Erysipelothrix rhusiopathiae GN=dnaJ PE=2 SV=1 20 82 1.0E-10
sp|P50027|DNAJH_SYNY3 DnAJ-like protein slr0093 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0093 PE=3 SV=1 20 103 1.0E-10
sp|O75190|DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens GN=DNAJB6 PE=1 SV=2 20 84 1.0E-10
sp|Q1GKS4|DNAJ_RUEST Chaperone protein DnaJ OS=Ruegeria sp. (strain TM1040) GN=dnaJ PE=3 SV=1 20 84 1.0E-10
sp|Q2GLU9|DNAJ_ANAPZ Chaperone protein DnaJ OS=Anaplasma phagocytophilum (strain HZ) GN=dnaJ PE=3 SV=1 20 93 1.0E-10
sp|Q5R8H0|DNJB6_PONAB DnaJ homolog subfamily B member 6 OS=Pongo abelii GN=DNAJB6 PE=2 SV=1 20 84 1.0E-10
sp|O34136|DNAJ_DEIPM Chaperone protein DnaJ OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaJ PE=3 SV=2 20 82 1.0E-10
sp|A9BNG6|DNAJ_DELAS Chaperone protein DnaJ OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaJ PE=3 SV=1 20 89 1.0E-10
sp|B7VJX0|DNAJ_VIBTL Chaperone protein DnaJ OS=Vibrio tasmaniensis (strain LGP32) GN=dnaJ PE=3 SV=1 20 84 1.0E-10
sp|B4F2V6|DNAJ_PROMH Chaperone protein DnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1 20 84 1.0E-10
sp|Q87RX2|DNAJ_VIBPA Chaperone protein DnaJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaJ PE=3 SV=1 20 84 1.0E-10
sp|Q03751|DNJC5_DROME DnaJ homolog subfamily C member 5 homolog OS=Drosophila melanogaster GN=Csp PE=1 SV=1 13 84 1.0E-10
sp|A6LJ63|DNAJ_THEM4 Chaperone protein DnaJ OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dnaJ PE=3 SV=1 20 82 1.0E-10
sp|Q75WD2|DNAJ_ACEP3 Chaperone protein DnaJ OS=Acetobacter pasteurianus (strain NBRC 3283 / LMG 1513 / CCTM 1153) GN=dnaJ PE=3 SV=2 15 84 1.0E-10
sp|A9MR76|DNAJ_SALAR Chaperone protein DnaJ OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaJ PE=3 SV=1 20 84 1.0E-10
sp|Q862Z4|DNJB3_MACFU DnaJ homolog subfamily B member 3 OS=Macaca fuscata fuscata GN=DNAJB3 PE=2 SV=1 18 92 2.0E-10
sp|Q6VAY5|DNAJ_PSEST Chaperone protein DnaJ OS=Pseudomonas stutzeri GN=dnaJ PE=3 SV=1 20 89 2.0E-10
sp|Q9CQ94|DNJ5B_MOUSE DnaJ homolog subfamily C member 5B OS=Mus musculus GN=Dnajc5b PE=1 SV=1 1 84 2.0E-10
sp|A6VCL7|DNAJ_PSEA7 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain PA7) GN=dnaJ PE=3 SV=1 20 89 2.0E-10
sp|Q9HV44|DNAJ_PSEAE Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dnaJ PE=3 SV=1 20 89 2.0E-10
sp|Q02FR2|DNAJ_PSEAB Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=dnaJ PE=3 SV=1 20 89 2.0E-10
sp|B7V1H2|DNAJ_PSEA8 Chaperone protein DnaJ OS=Pseudomonas aeruginosa (strain LESB58) GN=dnaJ PE=3 SV=1 20 89 2.0E-10
sp|Q8PAK8|DNAJ_XANCP Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=dnaJ PE=3 SV=1 20 84 2.0E-10
sp|Q4UT12|DNAJ_XANC8 Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain 8004) GN=dnaJ PE=3 SV=1 20 84 2.0E-10
sp|B0RVU1|DNAJ_XANCB Chaperone protein DnaJ OS=Xanthomonas campestris pv. campestris (strain B100) GN=dnaJ PE=3 SV=1 20 84 2.0E-10
sp|Q253T6|DNAJ_CHLFF Chaperone protein DnaJ OS=Chlamydophila felis (strain Fe/C-56) GN=dnaJ PE=3 SV=1 20 84 2.0E-10
sp|P63036|DNJA1_RAT DnaJ homolog subfamily A member 1 OS=Rattus norvegicus GN=Dnaja1 PE=1 SV=1 20 82 2.0E-10
sp|P63037|DNJA1_MOUSE DnaJ homolog subfamily A member 1 OS=Mus musculus GN=Dnaja1 PE=1 SV=1 20 82 2.0E-10
sp|Q3YT99|DNAJ_EHRCJ Chaperone protein DnaJ OS=Ehrlichia canis (strain Jake) GN=dnaJ PE=3 SV=1 16 84 2.0E-10
sp|Q8XIT1|DNAJ_CLOPE Chaperone protein DnaJ OS=Clostridium perfringens (strain 13 / Type A) GN=dnaJ PE=3 SV=1 20 82 2.0E-10
sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 20 82 2.0E-10
sp|A5FZ18|DNAJ_ACICJ Chaperone protein DnaJ OS=Acidiphilium cryptum (strain JF-5) GN=dnaJ PE=3 SV=1 20 82 2.0E-10
sp|A3PNM0|DNAJ_RHOS1 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dnaJ PE=3 SV=1 20 84 2.0E-10
sp|Q7NBW0|DNAJ_MYCGA Chaperone protein DnaJ OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=dnaJ PE=3 SV=2 15 93 2.0E-10
sp|Q0K758|DNAJ_CUPNH Chaperone protein DnaJ OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaJ PE=3 SV=1 20 89 2.0E-10
sp|Q9UBS3|DNJB9_HUMAN DnaJ homolog subfamily B member 9 OS=Homo sapiens GN=DNAJB9 PE=1 SV=1 10 94 2.0E-10
sp|B9KPP3|DNAJ_RHOSK Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=dnaJ PE=3 SV=1 20 84 2.0E-10
sp|A4WW88|DNAJ_RHOS5 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dnaJ PE=3 SV=1 20 84 2.0E-10
sp|Q3IYM8|DNAJ_RHOS4 Chaperone protein DnaJ OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dnaJ PE=3 SV=1 20 84 2.0E-10
sp|O42196|DNJC5_XENLA DnaJ homolog subfamily C member 5 OS=Xenopus laevis GN=dnajc5 PE=2 SV=1 6 84 2.0E-10
sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 20 82 2.0E-10
sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 20 82 2.0E-10
sp|O06431|DNAJ_NITEU Chaperone protein DnaJ OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dnaJ PE=3 SV=2 20 82 2.0E-10
sp|Q0A7E4|DNAJ_ALKEH Chaperone protein DnaJ OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dnaJ PE=3 SV=1 16 82 3.0E-10
sp|A6LRN5|DNAJ_CLOB8 Chaperone protein DnaJ OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaJ PE=3 SV=1 20 82 3.0E-10
sp|Q7Z6W7|DNJB7_HUMAN DnaJ homolog subfamily B member 7 OS=Homo sapiens GN=DNAJB7 PE=2 SV=2 20 140 3.0E-10
sp|C3LTA6|DNAJ_VIBCM Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dnaJ PE=3 SV=1 20 84 3.0E-10
sp|O34242|DNAJ_VIBCH Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dnaJ PE=3 SV=2 20 84 3.0E-10
sp|A5F362|DNAJ_VIBC3 Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dnaJ PE=3 SV=1 20 84 3.0E-10
sp|A1TLH8|DNAJ_ACIAC Chaperone protein DnaJ OS=Acidovorax citrulli (strain AAC00-1) GN=dnaJ PE=3 SV=1 20 82 3.0E-10
sp|A7MIK3|DNAJ_CROS8 Chaperone protein DnaJ OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaJ PE=3 SV=1 20 84 3.0E-10
sp|Q5LED4|DNAJ_BACFN Chaperone protein DnaJ OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=dnaJ PE=3 SV=1 20 90 3.0E-10
sp|Q64VI7|DNAJ_BACFR Chaperone protein DnaJ OS=Bacteroides fragilis (strain YCH46) GN=dnaJ PE=3 SV=1 20 90 3.0E-10
sp|A6T4F5|DNAJ_KLEP7 Chaperone protein DnaJ OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dnaJ PE=3 SV=1 20 84 3.0E-10
sp|B5Y241|DNAJ_KLEP3 Chaperone protein DnaJ OS=Klebsiella pneumoniae (strain 342) GN=dnaJ PE=3 SV=1 20 84 3.0E-10
sp|C4K3I5|DNAJ_HAMD5 Chaperone protein DnaJ OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=dnaJ PE=3 SV=1 20 107 3.0E-10
sp|Q1IF58|DNAJ_PSEE4 Chaperone protein DnaJ OS=Pseudomonas entomophila (strain L48) GN=dnaJ PE=3 SV=1 20 89 3.0E-10
sp|P40564|DJP1_YEAST DnaJ-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DJP1 PE=1 SV=1 20 115 3.0E-10
sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 6 137 3.0E-10
sp|A4G8D1|DNAJ_HERAR Chaperone protein DnaJ OS=Herminiimonas arsenicoxydans GN=dnaJ PE=3 SV=1 20 89 3.0E-10
sp|Q16D44|DNAJ_ROSDO Chaperone protein DnaJ OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=dnaJ PE=3 SV=1 20 84 3.0E-10
sp|Q316U7|DNAJ_DESAG Chaperone protein DnaJ OS=Desulfovibrio alaskensis (strain G20) GN=dnaJ PE=3 SV=1 20 82 3.0E-10
sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 20 82 3.0E-10
sp|Q5H185|DNAJ_XANOR Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=dnaJ PE=3 SV=1 20 84 4.0E-10
sp|B2SQU3|DNAJ_XANOP Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=dnaJ PE=3 SV=1 20 84 4.0E-10
sp|Q2P458|DNAJ_XANOM Chaperone protein DnaJ OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=dnaJ PE=3 SV=1 20 84 4.0E-10
sp|Q8PMA9|DNAJ_XANAC Chaperone protein DnaJ OS=Xanthomonas axonopodis pv. citri (strain 306) GN=dnaJ PE=3 SV=1 20 84 4.0E-10
sp|Q3BVB7|DNAJ_XANC5 Chaperone protein DnaJ OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=dnaJ PE=3 SV=1 20 84 4.0E-10
sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=1 SV=2 6 86 4.0E-10
sp|Q87BS9|DNAJ_XYLFT Chaperone protein DnaJ OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=dnaJ PE=3 SV=1 20 84 4.0E-10
sp|B2I6F5|DNAJ_XYLF2 Chaperone protein DnaJ OS=Xylella fastidiosa (strain M23) GN=dnaJ PE=3 SV=1 20 84 4.0E-10
sp|Q8D2Q6|DNAJ_WIGBR Chaperone protein DnaJ OS=Wigglesworthia glossinidia brevipalpis GN=dnaJ PE=3 SV=1 17 84 4.0E-10
sp|Q9PB06|DNAJ_XYLFA Chaperone protein DnaJ OS=Xylella fastidiosa (strain 9a5c) GN=dnaJ PE=3 SV=1 20 84 4.0E-10
sp|A1KR91|DNAJ_NEIMF Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dnaJ PE=3 SV=1 20 84 4.0E-10
sp|P63969|DNAJ_NEIMB Chaperone protein DnaJ OS=Neisseria meningitidis serogroup B (strain MC58) GN=dnaJ PE=3 SV=1 20 84 4.0E-10
sp|P63968|DNAJ_NEIMA Chaperone protein DnaJ OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dnaJ PE=3 SV=1 20 84 4.0E-10
sp|A9LZV9|DNAJ_NEIM0 Chaperone protein DnaJ OS=Neisseria meningitidis serogroup C (strain 053442) GN=dnaJ PE=3 SV=1 20 84 4.0E-10
sp|B0U3J7|DNAJ_XYLFM Chaperone protein DnaJ OS=Xylella fastidiosa (strain M12) GN=dnaJ PE=3 SV=1 20 84 4.0E-10
sp|Q74H58|DNAJ_GEOSL Chaperone protein DnaJ OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaJ PE=3 SV=1 20 82 4.0E-10
sp|B5YYA8|DNAJ_ECO5E Chaperone protein DnaJ OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dnaJ PE=3 SV=1 20 87 4.0E-10
sp|Q5QXL2|DNAJ_IDILO Chaperone protein DnaJ OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dnaJ PE=3 SV=1 20 84 4.0E-10
sp|Q9SDN0|DNJ20_ARATH Chaperone protein dnaJ 20, chloroplastic OS=Arabidopsis thaliana GN=ATJ20 PE=1 SV=2 19 82 4.0E-10
sp|A1V9Q3|DNAJ_DESVV Chaperone protein DnaJ OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaJ PE=3 SV=1 20 82 4.0E-10
sp|Q725M6|DNAJ_DESVH Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaJ PE=3 SV=1 20 82 4.0E-10
sp|Q3A8C3|DNAJ_PELCD Chaperone protein DnaJ OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaJ PE=3 SV=1 20 84 5.0E-10
sp|Q128K1|DNAJ_POLSJ Chaperone protein DnaJ OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dnaJ PE=3 SV=1 20 89 5.0E-10
sp|Q5F5M1|DNAJ_NEIG1 Chaperone protein DnaJ OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dnaJ PE=3 SV=1 20 84 5.0E-10
sp|A1WAR7|DNAJ_ACISJ Chaperone protein DnaJ OS=Acidovorax sp. (strain JS42) GN=dnaJ PE=3 SV=1 20 89 5.0E-10
sp|Q3Z600|DNAJ_SHISS Chaperone protein DnaJ OS=Shigella sonnei (strain Ss046) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|B7LVP7|DNAJ_ESCF3 Chaperone protein DnaJ OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|Q1RGI7|DNAJ_ECOUT Chaperone protein DnaJ OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|B1LFU5|DNAJ_ECOSM Chaperone protein DnaJ OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|B6HZ11|DNAJ_ECOSE Chaperone protein DnaJ OS=Escherichia coli (strain SE11) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|B7N7N9|DNAJ_ECOLU Chaperone protein DnaJ OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|B1IRF9|DNAJ_ECOLC Chaperone protein DnaJ OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|Q8FLC5|DNAJ_ECOL6 Chaperone protein DnaJ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaJ PE=3 SV=3 20 87 5.0E-10
sp|A7ZVV8|DNAJ_ECOHS Chaperone protein DnaJ OS=Escherichia coli O9:H4 (strain HS) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|B7M0B1|DNAJ_ECO8A Chaperone protein DnaJ OS=Escherichia coli O8 (strain IAI1) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|B7MNM2|DNAJ_ECO81 Chaperone protein DnaJ OS=Escherichia coli O81 (strain ED1a) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|B7NHB7|DNAJ_ECO7I Chaperone protein DnaJ OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|Q8XA65|DNAJ_ECO57 Chaperone protein DnaJ OS=Escherichia coli O157:H7 GN=dnaJ PE=3 SV=3 20 87 5.0E-10
sp|B7L4D9|DNAJ_ECO55 Chaperone protein DnaJ OS=Escherichia coli (strain 55989 / EAEC) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|B7MAD6|DNAJ_ECO45 Chaperone protein DnaJ OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|B7UI60|DNAJ_ECO27 Chaperone protein DnaJ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|A7ZHA5|DNAJ_ECO24 Chaperone protein DnaJ OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|Q9HGM9|DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.02c PE=3 SV=1 21 93 5.0E-10
sp|Q326K6|DNAJ_SHIBS Chaperone protein DnaJ OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|B2U233|DNAJ_SHIB3 Chaperone protein DnaJ OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dnaJ PE=3 SV=1 20 87 5.0E-10
sp|B5BLH9|DNAJ_SALPK Chaperone protein DnaJ OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaJ PE=3 SV=1 20 84 6.0E-10
sp|Q5PDJ4|DNAJ_SALPA Chaperone protein DnaJ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaJ PE=3 SV=3 20 84 6.0E-10
sp|Q32KA4|DNAJ_SHIDS Chaperone protein DnaJ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaJ PE=3 SV=1 20 87 6.0E-10
sp|Q5LWJ5|DNAJ_RUEPO Chaperone protein DnaJ OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dnaJ PE=3 SV=1 20 82 6.0E-10
sp|P0A1G7|DNAJ_SALTY Chaperone protein DnaJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaJ PE=3 SV=2 20 84 6.0E-10
sp|P0A1G8|DNAJ_SALTI Chaperone protein DnaJ OS=Salmonella typhi GN=dnaJ PE=3 SV=2 20 84 6.0E-10
sp|B4TVZ6|DNAJ_SALSV Chaperone protein DnaJ OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaJ PE=3 SV=1 20 84 6.0E-10
sp|C0Q4F4|DNAJ_SALPC Chaperone protein DnaJ OS=Salmonella paratyphi C (strain RKS4594) GN=dnaJ PE=3 SV=1 20 84 6.0E-10
sp|A9MXI3|DNAJ_SALPB Chaperone protein DnaJ OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaJ PE=3 SV=1 20 84 6.0E-10
sp|B4T6D7|DNAJ_SALNS Chaperone protein DnaJ OS=Salmonella newport (strain SL254) GN=dnaJ PE=3 SV=1 20 84 6.0E-10
sp|B4TIB5|DNAJ_SALHS Chaperone protein DnaJ OS=Salmonella heidelberg (strain SL476) GN=dnaJ PE=3 SV=1 20 84 6.0E-10
sp|B5RF09|DNAJ_SALG2 Chaperone protein DnaJ OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaJ PE=3 SV=1 20 84 6.0E-10
sp|B5R5I3|DNAJ_SALEP Chaperone protein DnaJ OS=Salmonella enteritidis PT4 (strain P125109) GN=dnaJ PE=3 SV=1 20 84 6.0E-10
sp|B5FHA7|DNAJ_SALDC Chaperone protein DnaJ OS=Salmonella dublin (strain CT_02021853) GN=dnaJ PE=3 SV=1 20 84 6.0E-10
sp|Q57TP2|DNAJ_SALCH Chaperone protein DnaJ OS=Salmonella choleraesuis (strain SC-B67) GN=dnaJ PE=3 SV=3 20 84 6.0E-10
sp|B5F6Y9|DNAJ_SALA4 Chaperone protein DnaJ OS=Salmonella agona (strain SL483) GN=dnaJ PE=3 SV=1 20 84 6.0E-10
sp|Q8EHT6|DNAJ_SHEON Chaperone protein DnaJ OS=Shewanella oneidensis (strain MR-1) GN=dnaJ PE=3 SV=1 20 82 6.0E-10
sp|Q0HY10|DNAJ_SHESR Chaperone protein DnaJ OS=Shewanella sp. (strain MR-7) GN=dnaJ PE=3 SV=1 20 82 6.0E-10
sp|Q0HLM9|DNAJ_SHESM Chaperone protein DnaJ OS=Shewanella sp. (strain MR-4) GN=dnaJ PE=3 SV=1 20 82 6.0E-10
sp|A0KTS6|DNAJ_SHESA Chaperone protein DnaJ OS=Shewanella sp. (strain ANA-3) GN=dnaJ PE=3 SV=1 20 82 6.0E-10
sp|Q9QYI6|DNJB9_MOUSE DnaJ homolog subfamily B member 9 OS=Mus musculus GN=Dnajb9 PE=1 SV=2 10 94 6.0E-10
sp|B2VGS0|DNAJ_ERWT9 Chaperone protein DnaJ OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dnaJ PE=3 SV=1 20 84 6.0E-10
sp|Q73Q15|DNAJ_TREDE Chaperone protein DnaJ OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dnaJ PE=3 SV=2 13 82 6.0E-10
sp|Q5WHG0|DNAJ_BACSK Chaperone protein DnaJ OS=Bacillus clausii (strain KSM-K16) GN=dnaJ PE=3 SV=1 20 82 7.0E-10
sp|A0KMI5|DNAJ_AERHH Chaperone protein DnaJ OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaJ PE=3 SV=1 20 92 7.0E-10
sp|C4L424|DNAJ_EXISA Chaperone protein DnaJ OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=dnaJ PE=3 SV=1 20 82 7.0E-10
sp|A4SQ24|DNAJ_AERS4 Chaperone protein DnaJ OS=Aeromonas salmonicida (strain A449) GN=dnaJ PE=3 SV=1 20 92 7.0E-10
sp|Q73IV4|DNAJ_WOLPM Chaperone protein DnaJ OS=Wolbachia pipientis wMel GN=dnaJ PE=3 SV=1 20 84 7.0E-10
sp|A1AW21|DNAJ_RUTMC Chaperone protein DnaJ OS=Ruthia magnifica subsp. Calyptogena magnifica GN=dnaJ PE=3 SV=1 20 82 7.0E-10
sp|Q3AF07|DNAJ_CARHZ Chaperone protein DnaJ OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaJ PE=3 SV=1 20 82 7.0E-10
sp|Q5R9A4|DNJB9_PONAB DnaJ homolog subfamily B member 9 OS=Pongo abelii GN=DNAJB9 PE=2 SV=1 10 94 7.0E-10
sp|A1U613|DNAJ_MARHV Chaperone protein DnaJ OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaJ PE=3 SV=1 20 91 8.0E-10
sp|A5WBF8|DNAJ_PSYWF Chaperone protein DnaJ OS=Psychrobacter sp. (strain PRwf-1) GN=dnaJ PE=3 SV=1 20 82 8.0E-10
sp|Q9H819|DJC18_HUMAN DnaJ homolog subfamily C member 18 OS=Homo sapiens GN=DNAJC18 PE=2 SV=1 3 130 8.0E-10
sp|Q8RH03|DNAJ_FUSNN Chaperone protein DnaJ OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=dnaJ PE=3 SV=1 20 82 8.0E-10
sp|Q1LJ82|DNAJ_CUPMC Chaperone protein DnaJ OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dnaJ PE=3 SV=1 20 89 8.0E-10
sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 20 84 8.0E-10
sp|Q5EA26|DJC18_BOVIN DnaJ homolog subfamily C member 18 OS=Bos taurus GN=DNAJC18 PE=2 SV=1 3 130 8.0E-10
sp|Q0VST5|DNAJ_ALCBS Chaperone protein DnaJ OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dnaJ PE=3 SV=1 20 82 8.0E-10
sp|Q3SIN3|DNAJ_THIDA Chaperone protein DnaJ OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaJ PE=3 SV=1 20 82 9.0E-10
sp|Q607A6|DNAJ_METCA Chaperone protein DnaJ OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dnaJ PE=3 SV=1 20 92 9.0E-10
sp|A5CX57|DNAJ_VESOH Chaperone protein DnaJ OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=dnaJ PE=3 SV=1 20 92 9.0E-10
sp|Q2NVZ0|DNAJ_SODGM Chaperone protein DnaJ OS=Sodalis glossinidius (strain morsitans) GN=dnaJ PE=3 SV=1 17 84 9.0E-10
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 20 84 9.0E-10
sp|P56101|DNJC5_TORCA DnaJ homolog subfamily C member 5 OS=Torpedo californica GN=dnajc5 PE=1 SV=1 8 84 9.0E-10
sp|C1DFM2|DNAJ_AZOVD Chaperone protein DnaJ OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=dnaJ PE=3 SV=1 20 89 9.0E-10
sp|B0VA24|DNAJ_ACIBY Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AYE) GN=dnaJ PE=3 SV=1 20 82 9.0E-10
sp|A3MA88|DNAJ_ACIBT Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaJ PE=3 SV=2 20 82 9.0E-10
sp|B0VQ00|DNAJ_ACIBS Chaperone protein DnaJ OS=Acinetobacter baumannii (strain SDF) GN=dnaJ PE=3 SV=1 20 82 9.0E-10
sp|B2I2G6|DNAJ_ACIBC Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ACICU) GN=dnaJ PE=3 SV=1 20 82 9.0E-10
sp|B7I2B2|DNAJ_ACIB5 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB0057) GN=dnaJ PE=3 SV=1 20 82 9.0E-10
sp|B7GV08|DNAJ_ACIB3 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaJ PE=3 SV=1 20 82 9.0E-10
sp|B8CKF4|DNAJ_SHEPW Chaperone protein DnaJ OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=dnaJ PE=3 SV=1 20 82 1.0E-09
sp|Q3J7D9|DNAJ_NITOC Chaperone protein DnaJ OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=dnaJ PE=3 SV=1 20 82 1.0E-09
sp|B3R6G6|DNAJ_CUPTR Chaperone protein DnaJ OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaJ PE=3 SV=1 20 89 1.0E-09
sp|Q9LZK5|DNJ19_ARATH DnaJ protein ERDJ3B OS=Arabidopsis thaliana GN=ERDJ3B PE=1 SV=1 20 84 1.0E-09
sp|Q88DU3|DNAJ_PSEPK Chaperone protein DnaJ OS=Pseudomonas putida (strain KT2440) GN=dnaJ PE=3 SV=1 20 89 1.0E-09
sp|B9MDJ8|DNAJ_ACIET Chaperone protein DnaJ OS=Acidovorax ebreus (strain TPSY) GN=dnaJ PE=3 SV=1 20 89 1.0E-09
sp|Q9CMS2|DNAJ_PASMU Chaperone protein DnaJ OS=Pasteurella multocida (strain Pm70) GN=dnaJ PE=3 SV=1 20 84 1.0E-09
sp|D3ZD82|DNJ5B_RAT DnaJ homolog subfamily C member 5B OS=Rattus norvegicus GN=Dnajc5b PE=1 SV=1 1 84 1.0E-09
sp|Q2KIJ8|DNJ5B_BOVIN DnaJ homolog subfamily C member 5B OS=Bos taurus GN=DNAJC5B PE=2 SV=1 1 84 1.0E-09
sp|O33529|DNAJ_RHILE Chaperone protein DnaJ (Fragment) OS=Rhizobium leguminosarum GN=dnaJ PE=3 SV=1 17 84 1.0E-09
sp|P39102|XDJ1_YEAST DnaJ protein homolog XDJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XDJ1 PE=1 SV=2 20 86 1.0E-09
sp|A5W9A2|DNAJ_PSEP1 Chaperone protein DnaJ OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=dnaJ PE=3 SV=1 20 89 1.0E-09
sp|Q8RB67|DNAJ_CALS4 Chaperone protein DnaJ OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dnaJ PE=3 SV=1 20 82 1.0E-09
sp|P30725|DNAJ_CLOAB Chaperone protein DnaJ OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaJ PE=2 SV=2 20 82 1.0E-09
sp|Q3IC07|DNAJ_PSEHT Chaperone protein DnaJ OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dnaJ PE=3 SV=1 20 84 1.0E-09
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 20 82 1.0E-09
sp|B2V2I6|DNAJ_CLOBA Chaperone protein DnaJ OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaJ PE=3 SV=1 20 82 1.0E-09
sp|B2TLZ8|DNAJ_CLOBB Chaperone protein DnaJ OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaJ PE=3 SV=1 20 82 1.0E-09
sp|Q9FL54|DNAJ6_ARATH Chaperone protein dnaJ 6 OS=Arabidopsis thaliana GN=ATJ6 PE=2 SV=1 15 91 1.0E-09
sp|Q6MNG0|DNAJ_BDEBA Chaperone protein DnaJ OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaJ PE=3 SV=1 20 82 1.0E-09
sp|Q0T8H5|DNAJ_SHIF8 Chaperone protein DnaJ OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaJ PE=3 SV=1 20 87 1.0E-09
sp|B9KAB9|DNAJ_THENN Chaperone protein DnaJ OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dnaJ PE=3 SV=1 20 82 1.0E-09
sp|P08622|DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3 20 87 1.0E-09
sp|B1XBE0|DNAJ_ECODH Chaperone protein DnaJ OS=Escherichia coli (strain K12 / DH10B) GN=dnaJ PE=3 SV=1 20 87 1.0E-09
sp|A4XYF5|DNAJ_PSEMY Chaperone protein DnaJ OS=Pseudomonas mendocina (strain ymp) GN=dnaJ PE=3 SV=1 20 89 1.0E-09
sp|Q5WV16|DNAJ_LEGPL Chaperone protein DnaJ OS=Legionella pneumophila (strain Lens) GN=dnaJ PE=3 SV=1 20 82 1.0E-09
sp|Q601X8|DNAJ_MYCH2 Chaperone protein DnaJ OS=Mycoplasma hyopneumoniae (strain 232) GN=dnaJ PE=3 SV=2 20 82 1.0E-09
sp|C4ZPU1|DNAJ_ECOBW Chaperone protein DnaJ OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dnaJ PE=3 SV=1 20 87 1.0E-09
sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 20 84 1.0E-09
sp|Q12Q07|DNAJ_SHEDO Chaperone protein DnaJ OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaJ PE=3 SV=1 20 82 2.0E-09
sp|Q6F6R1|DNAJ_ACIAD Chaperone protein DnaJ OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaJ PE=3 SV=1 20 82 2.0E-09
sp|Q2KDW7|DNAJ_RHIEC Chaperone protein DnaJ OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=dnaJ PE=3 SV=1 17 84 2.0E-09
sp|Q5BIP8|DNJB5_BOVIN DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1 20 84 2.0E-09
sp|P50025|DNAJ_LEGPN Chaperone protein DnaJ OS=Legionella pneumophila GN=dnaJ PE=3 SV=1 20 82 2.0E-09
sp|Q5ZTY4|DNAJ_LEGPH Chaperone protein DnaJ OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaJ PE=3 SV=1 20 82 2.0E-09
sp|A5IDK7|DNAJ_LEGPC Chaperone protein DnaJ OS=Legionella pneumophila (strain Corby) GN=dnaJ PE=3 SV=1 20 82 2.0E-09
sp|Q5X3M8|DNAJ_LEGPA Chaperone protein DnaJ OS=Legionella pneumophila (strain Paris) GN=dnaJ PE=3 SV=1 20 82 2.0E-09
sp|P97554|DNJB9_RAT DnaJ homolog subfamily B member 9 OS=Rattus norvegicus GN=Dnajb9 PE=2 SV=2 20 97 2.0E-09
sp|Q7UDU1|DNAJ_SHIFL Chaperone protein DnaJ OS=Shigella flexneri GN=dnaJ PE=3 SV=3 20 84 2.0E-09
sp|Q72GN6|DNAJ_THET2 Chaperone protein DnaJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaJ PE=3 SV=1 20 87 2.0E-09
sp|Q057X7|DNAJ_BUCCC Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=dnaJ PE=3 SV=1 16 84 2.0E-09
sp|Q9LYW9|DNJ36_ARATH DnaJ protein P58IPK homolog OS=Arabidopsis thaliana GN=P58IPK PE=1 SV=1 20 82 2.0E-09
sp|Q04Y48|DNAJ_LEPBL Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=dnaJ PE=3 SV=1 20 82 2.0E-09
sp|Q04VC7|DNAJ_LEPBJ Chaperone protein DnaJ OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=dnaJ PE=3 SV=1 20 82 2.0E-09
sp|Q5SLW9|DNAJ1_THET8 Chaperone protein DnaJ 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ1 PE=3 SV=1 20 87 2.0E-09
sp|Q9PK53|DNAJ_CHLMU Chaperone protein DnaJ OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dnaJ PE=3 SV=1 20 84 2.0E-09
sp|C3K274|DNAJ_PSEFS Chaperone protein DnaJ OS=Pseudomonas fluorescens (strain SBW25) GN=dnaJ PE=3 SV=1 20 89 2.0E-09
sp|P94319|DNAJ_BRADU Chaperone protein DnaJ OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=dnaJ PE=3 SV=1 14 82 2.0E-09
sp|A1VMG1|DNAJ_POLNA Chaperone protein DnaJ OS=Polaromonas naphthalenivorans (strain CJ2) GN=dnaJ PE=3 SV=1 20 89 2.0E-09
sp|Q0C454|DNAJ_HYPNA Chaperone protein DnaJ OS=Hyphomonas neptunium (strain ATCC 15444) GN=dnaJ PE=3 SV=1 20 84 2.0E-09
sp|B7IFE0|DNAJ_THEAB Chaperone protein DnaJ OS=Thermosipho africanus (strain TCF52B) GN=dnaJ PE=3 SV=1 20 82 2.0E-09
sp|O84345|DNAJ_CHLTR Chaperone protein DnaJ OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dnaJ PE=3 SV=1 20 84 2.0E-09
sp|B0BBX5|DNAJ_CHLTB Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dnaJ PE=3 SV=1 20 84 2.0E-09
sp|Q3KM17|DNAJ_CHLTA Chaperone protein DnaJ OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dnaJ PE=3 SV=1 20 84 2.0E-09
sp|B0B7R0|DNAJ_CHLT2 Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dnaJ PE=3 SV=1 20 84 2.0E-09
sp|P47265|DNAJ_MYCGE Chaperone protein DnaJ OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaJ PE=3 SV=1 20 93 2.0E-09
sp|B9JZ89|DNAJ_AGRVS Chaperone protein DnaJ OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaJ PE=3 SV=1 17 82 2.0E-09
sp|Q9LCQ4|DNAJ_BRECH Chaperone protein DnaJ OS=Brevibacillus choshinensis GN=dnaJ PE=3 SV=1 20 86 2.0E-09
sp|Q98DD2|DNAJ_RHILO Chaperone protein DnaJ OS=Rhizobium loti (strain MAFF303099) GN=dnaJ PE=3 SV=1 17 82 2.0E-09
sp|B1ZUS0|DNAJ_OPITP Chaperone protein DnaJ OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=dnaJ PE=3 SV=1 20 84 2.0E-09
sp|C6DF09|DNAJ_PECCP Chaperone protein DnaJ OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=dnaJ PE=3 SV=1 20 84 2.0E-09
sp|A3QGW1|DNAJ_SHELP Chaperone protein DnaJ OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=dnaJ PE=3 SV=1 20 82 2.0E-09
sp|P61441|DNAJ_LEPIN Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=dnaJ PE=3 SV=1 20 82 2.0E-09
sp|P61440|DNAJ_LEPIC Chaperone protein DnaJ OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=dnaJ PE=3 SV=1 20 82 2.0E-09
sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 6 86 3.0E-09
sp|Q28I38|DJB14_XENTR DnaJ homolog subfamily B member 14 OS=Xenopus tropicalis GN=dnajb14 PE=2 SV=1 6 82 3.0E-09
sp|F1RTY8|DNJ5B_PIG DnaJ homolog subfamily C member 5B OS=Sus scrofa GN=DNAJC5B PE=3 SV=1 1 84 3.0E-09
sp|Q2J319|DNAJ_RHOP2 Chaperone protein DnaJ OS=Rhodopseudomonas palustris (strain HaA2) GN=dnaJ PE=3 SV=1 13 84 3.0E-09
sp|Q8TQR1|DNAJ_METAC Chaperone protein DnaJ OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaJ PE=3 SV=1 15 82 3.0E-09
sp|A4XKA5|DNAJ_CALS8 Chaperone protein DnaJ OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=dnaJ PE=3 SV=1 20 82 3.0E-09
sp|B0SRF0|DNAJ_LEPBP Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dnaJ PE=3 SV=1 20 82 3.0E-09
sp|B0SHT0|DNAJ_LEPBA Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dnaJ PE=3 SV=1 20 82 3.0E-09
sp|Q6D0B8|DNAJ_PECAS Chaperone protein DnaJ OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dnaJ PE=3 SV=1 20 84 3.0E-09
sp|B1J255|DNAJ_PSEPW Chaperone protein DnaJ OS=Pseudomonas putida (strain W619) GN=dnaJ PE=3 SV=1 20 89 3.0E-09
sp|A1B4F0|DNAJ_PARDP Chaperone protein DnaJ OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaJ PE=3 SV=1 20 82 3.0E-09
sp|B8HLD2|DNAJ_CYAP4 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=dnaJ PE=3 SV=1 20 92 3.0E-09
sp|B0KIS4|DNAJ_PSEPG Chaperone protein DnaJ OS=Pseudomonas putida (strain GB-1) GN=dnaJ PE=3 SV=1 20 89 3.0E-09
sp|Q4FVQ7|DNAJ_PSYA2 Chaperone protein DnaJ OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dnaJ PE=3 SV=1 20 82 3.0E-09
sp|P47442|DNAJM_MYCGE DnaJ-like protein MG200 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG200 PE=1 SV=1 13 105 3.0E-09
sp|A0Q1R3|DNAJ_CLONN Chaperone protein DnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1 20 82 3.0E-09
sp|Q8WWF6|DNJB3_HUMAN DnaJ homolog subfamily B member 3 OS=Homo sapiens GN=DNAJB3 PE=1 SV=1 20 92 4.0E-09
sp|Q1QET5|DNAJ_PSYCK Chaperone protein DnaJ OS=Psychrobacter cryohalolentis (strain K5) GN=dnaJ PE=3 SV=1 20 82 4.0E-09
sp|Q1QSX1|DNAJ_CHRSD Chaperone protein DnaJ OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=dnaJ PE=3 SV=1 20 91 4.0E-09
sp|Q8KRC9|DNAJ_MYXXA Chaperone protein DnaJ OS=Myxococcus xanthus GN=dnaJ PE=3 SV=1 20 82 4.0E-09
sp|B3PXH2|DNAJ_RHIE6 Chaperone protein DnaJ OS=Rhizobium etli (strain CIAT 652) GN=dnaJ PE=3 SV=1 17 84 4.0E-09
sp|Q8L397|DNAJ_ACHLA Chaperone protein DnaJ OS=Acholeplasma laidlawii GN=dnaJ PE=3 SV=1 20 82 4.0E-09
sp|Q4FNQ0|DNAJ_PELUB Chaperone protein DnaJ OS=Pelagibacter ubique (strain HTCC1062) GN=dnaJ PE=3 SV=1 20 83 4.0E-09
sp|Q7VEJ6|DNAJ_PROMA Chaperone protein DnaJ OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaJ PE=3 SV=1 20 92 4.0E-09
sp|Q28VY4|DNAJ_JANSC Chaperone protein DnaJ OS=Jannaschia sp. (strain CCS1) GN=dnaJ PE=3 SV=1 20 82 4.0E-09
sp|Q1MN12|DNAJ_RHIL3 Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dnaJ PE=3 SV=1 17 84 4.0E-09
sp|Q49Y21|DNAJ_STAS1 Chaperone protein DnaJ OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaJ PE=3 SV=1 20 82 5.0E-09
sp|B5ZWQ1|DNAJ_RHILW Chaperone protein DnaJ OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=dnaJ PE=3 SV=1 17 84 5.0E-09
sp|Q5HNW7|DNAJ_STAEQ Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaJ PE=3 SV=1 20 82 5.0E-09
sp|Q493S6|DNAJ_BLOPB Chaperone protein DnaJ OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaJ PE=3 SV=1 17 131 5.0E-09
sp|P28616|DNAJ_BORBU Chaperone protein DnaJ OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=dnaJ PE=2 SV=2 20 82 5.0E-09
sp|Q70WY6|DNAJ_FUSNP Chaperone protein DnaJ OS=Fusobacterium nucleatum subsp. polymorphum GN=dnaJ PE=3 SV=1 20 82 5.0E-09
sp|Q71ZJ8|DNAJ_LISMF Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaJ PE=3 SV=1 20 84 5.0E-09
sp|C1KVB9|DNAJ_LISMC Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaJ PE=3 SV=1 20 84 5.0E-09
sp|B9JGW2|DNAJ_AGRRK Chaperone protein DnaJ OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=dnaJ PE=3 SV=1 17 84 5.0E-09
sp|Q09912|PSI1_SCHPO Protein psi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psi1 PE=2 SV=2 20 84 5.0E-09
sp|C4L8Y4|DNAJ_TOLAT Chaperone protein DnaJ OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaJ PE=3 SV=1 20 82 5.0E-09
sp|A1JJD6|DNAJ_YERE8 Chaperone protein DnaJ OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaJ PE=3 SV=1 20 84 5.0E-09
sp|P42824|DNJH2_ALLPO DnaJ protein homolog 2 OS=Allium porrum GN=LDJ2 PE=2 SV=1 20 84 5.0E-09
sp|Q8CP18|DNAJ_STAES Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaJ PE=3 SV=1 20 82 6.0E-09
sp|P0CW06|DNAJ_METMZ Chaperone protein DnaJ OS=Methanosarcina mazei GN=dnaJ PE=3 SV=1 15 116 6.0E-09
sp|P0CW07|DNAJ_METMA Chaperone protein DnaJ OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dnaJ PE=3 SV=1 15 116 6.0E-09
sp|C5BQ32|DNAJ_TERTT Chaperone protein DnaJ OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dnaJ PE=3 SV=1 20 82 6.0E-09
sp|O32465|DNAJ_BUCAI Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaJ PE=3 SV=2 20 84 6.0E-09
sp|B8D8V3|DNAJ_BUCA5 Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=dnaJ PE=3 SV=1 20 84 6.0E-09
sp|B8D757|DNAJ_BUCAT Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=dnaJ PE=3 SV=1 20 84 6.0E-09
sp|Q6XL73|DNJ39_ARATH Chaperone protein dnaJ 39 OS=Arabidopsis thaliana GN=ATJ39 PE=2 SV=2 21 83 6.0E-09
sp|B8CXL0|DNAJ_HALOH Chaperone protein DnaJ OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaJ PE=3 SV=1 20 90 6.0E-09
sp|Q8GYX8|DNJ10_ARATH Chaperone protein dnaJ 10 OS=Arabidopsis thaliana GN=ATJ10 PE=2 SV=2 20 89 6.0E-09
sp|Q0AIY0|DNAJ_NITEC Chaperone protein DnaJ OS=Nitrosomonas eutropha (strain C91) GN=dnaJ PE=3 SV=1 20 82 6.0E-09
sp|B1Y787|DNAJ_LEPCP Chaperone protein DnaJ OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaJ PE=3 SV=1 20 82 6.0E-09
sp|Q6AEC0|DNAJ_LEIXX Chaperone protein DnaJ OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=dnaJ PE=3 SV=1 21 82 6.0E-09
sp|A1WX30|DNAJ_HALHL Chaperone protein DnaJ OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=dnaJ PE=3 SV=1 20 92 6.0E-09
sp|Q6ME07|DNAJ_PARUW Chaperone protein DnaJ OS=Protochlamydia amoebophila (strain UWE25) GN=dnaJ PE=3 SV=1 20 84 6.0E-09
sp|Q89AU7|DNAJ_BUCBP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dnaJ PE=3 SV=1 20 84 6.0E-09
sp|B0TQC1|DNAJ_SHEHH Chaperone protein DnaJ OS=Shewanella halifaxensis (strain HAW-EB4) GN=dnaJ PE=3 SV=1 20 82 6.0E-09
sp|Q95KD5|DJC18_MACFA DnaJ homolog subfamily C member 18 OS=Macaca fascicularis GN=DNAJC18 PE=2 SV=1 2 90 6.0E-09
sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 6 86 6.0E-09
sp|A1S8K6|DNAJ_SHEAM Chaperone protein DnaJ OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=dnaJ PE=3 SV=1 20 82 7.0E-09
sp|A8G9K9|DNAJ_SERP5 Chaperone protein DnaJ OS=Serratia proteamaculans (strain 568) GN=dnaJ PE=3 SV=1 20 87 7.0E-09
sp|B8GNX2|DNAJ_THISH Chaperone protein DnaJ OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaJ PE=3 SV=1 20 82 7.0E-09
sp|B8DE39|DNAJ_LISMH Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaJ PE=3 SV=1 20 84 7.0E-09
sp|Q92BN9|DNAJ_LISIN Chaperone protein DnaJ OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dnaJ PE=3 SV=1 20 84 7.0E-09
sp|P0DJM1|DNAJ_LISMO Chaperone protein DnaJ OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dnaJ PE=3 SV=1 20 84 7.0E-09
sp|G2K045|DNAJ_LISM4 Chaperone protein DnaJ OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=dnaJ PE=3 SV=1 20 84 7.0E-09
sp|Q7WGI5|DNAJ_BORBR Chaperone protein DnaJ OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaJ PE=3 SV=1 20 89 7.0E-09
sp|A7GT07|DNAJ_BACCN Chaperone protein DnaJ OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaJ PE=3 SV=1 20 82 7.0E-09
sp|C5B7L8|DNAJ_EDWI9 Chaperone protein DnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1 20 84 7.0E-09
sp|Q7W520|DNAJ_BORPA Chaperone protein DnaJ OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaJ PE=3 SV=1 20 89 7.0E-09
sp|Q7VVY3|DNAJ_BORPE Chaperone protein DnaJ OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaJ PE=3 SV=1 20 89 7.0E-09
sp|Q661A4|DNAJ_BORBP Chaperone protein DnaJ OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=dnaJ PE=3 SV=1 20 82 8.0E-09
sp|Q65U54|DNAJ_MANSM Chaperone protein DnaJ OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dnaJ PE=3 SV=2 20 84 8.0E-09
sp|Q8TBM8|DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens GN=DNAJB14 PE=1 SV=1 9 82 9.0E-09
sp|P50018|DNAJ_AGRFC Chaperone protein DnaJ OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaJ PE=2 SV=2 17 82 9.0E-09
sp|Q149L6|DJB14_MOUSE DnaJ homolog subfamily B member 14 OS=Mus musculus GN=Dnajb14 PE=2 SV=1 9 82 9.0E-09
sp|Q0IIE8|DJB14_BOVIN DnaJ homolog subfamily B member 14 OS=Bos taurus GN=DNAJB14 PE=2 SV=1 9 82 9.0E-09
sp|O66921|DNAJ2_AQUAE Chaperone protein DnaJ 2 OS=Aquifex aeolicus (strain VF5) GN=dnaJ2 PE=3 SV=1 14 93 9.0E-09
sp|Q8XW41|DNAJ_RALSO Chaperone protein DnaJ OS=Ralstonia solanacearum (strain GMI1000) GN=dnaJ PE=3 SV=1 20 89 1.0E-08
sp|Q086J2|DNAJ_SHEFN Chaperone protein DnaJ OS=Shewanella frigidimarina (strain NCIMB 400) GN=dnaJ PE=3 SV=1 20 82 1.0E-08
sp|A2SIR5|DNAJ_METPP Chaperone protein DnaJ OS=Methylibium petroleiphilum (strain PM1) GN=dnaJ PE=3 SV=1 20 95 1.0E-08
sp|Q98PI9|DNAJ_MYCPU Chaperone protein DnaJ OS=Mycoplasma pulmonis (strain UAB CTIP) GN=dnaJ PE=3 SV=2 20 84 1.0E-08
sp|Q61712|DNJC1_MOUSE DnaJ homolog subfamily C member 1 OS=Mus musculus GN=Dnajc1 PE=1 SV=1 20 119 1.0E-08
sp|Q04960|DNJH_CUCSA DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1 20 84 1.0E-08
sp|C0ZB49|DNAJ_BREBN Chaperone protein DnaJ OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=dnaJ PE=3 SV=1 20 86 1.0E-08
sp|O08356|DNAJ_RHOS7 Chaperone protein DnaJ OS=Rhodopseudomonas sp. (strain No.7) GN=dnaJ PE=3 SV=1 13 84 1.0E-08
sp|B3Q973|DNAJ_RHOPT Chaperone protein DnaJ OS=Rhodopseudomonas palustris (strain TIE-1) GN=dnaJ PE=3 SV=1 13 84 1.0E-08
sp|Q6NCY3|DNAJ_RHOPA Chaperone protein DnaJ OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=dnaJ PE=3 SV=1 13 84 1.0E-08
sp|A4Y9Q2|DNAJ_SHEPC Chaperone protein DnaJ OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=dnaJ PE=3 SV=1 20 82 1.0E-08
sp|A1RGN2|DNAJ_SHESW Chaperone protein DnaJ OS=Shewanella sp. (strain W3-18-1) GN=dnaJ PE=3 SV=1 20 82 1.0E-08
sp|Q6G553|DNAJ_BARHE Chaperone protein DnaJ OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaJ PE=3 SV=1 20 95 1.0E-08
sp|A6UEY1|DNAJ_SINMW Chaperone protein DnaJ OS=Sinorhizobium medicae (strain WSM419) GN=dnaJ PE=3 SV=1 20 84 1.0E-08
sp|A9KKT9|DNAJ_CLOPH Chaperone protein DnaJ OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=dnaJ PE=3 SV=1 20 82 1.0E-08
sp|Q11KJ5|DNAJ_CHESB Chaperone protein DnaJ OS=Chelativorans sp. (strain BNC1) GN=dnaJ PE=3 SV=1 17 82 1.0E-08
sp|Q1H3B9|DNAJ_METFK Chaperone protein DnaJ OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaJ PE=3 SV=1 20 92 1.0E-08
sp|B0JW23|DNAJ_MICAN Chaperone protein DnaJ OS=Microcystis aeruginosa (strain NIES-843) GN=dnaJ PE=3 SV=1 20 92 1.0E-08
sp|Q21CI1|DNAJ_RHOPB Chaperone protein DnaJ OS=Rhodopseudomonas palustris (strain BisB18) GN=dnaJ PE=3 SV=1 13 84 1.0E-08
sp|Q46XI8|DNAJ_CUPPJ Chaperone protein DnaJ OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=dnaJ PE=3 SV=1 20 89 1.0E-08
sp|Q8KCD8|DNAJ_CHLTE Chaperone protein DnaJ OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaJ PE=3 SV=1 20 82 1.0E-08
sp|Q3MI00|DNJB1_BOVIN DnaJ homolog subfamily B member 1 OS=Bos taurus GN=DNAJB1 PE=2 SV=3 20 84 1.0E-08
sp|O35723|DNJB3_MOUSE DnaJ homolog subfamily B member 3 OS=Mus musculus GN=Dnajb3 PE=2 SV=1 20 82 1.0E-08
sp|Q0I3V1|DNAJ_HAES1 Chaperone protein DnaJ OS=Haemophilus somnus (strain 129Pt) GN=dnaJ PE=3 SV=1 20 84 1.0E-08
sp|B0UWR3|DNAJ_HISS2 Chaperone protein DnaJ OS=Histophilus somni (strain 2336) GN=dnaJ PE=3 SV=1 20 84 1.0E-08
sp|Q8K9Y9|DNAJ_BUCAP Chaperone protein DnaJ OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaJ PE=3 SV=1 20 84 1.0E-08
sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens GN=DNAJB1 PE=1 SV=4 20 84 1.0E-08
sp|Q9ZFC5|DNAJ_METSS Chaperone protein DnaJ OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=dnaJ PE=3 SV=1 20 96 1.0E-08
sp|A5UYW4|DNAJ_ROSS1 Chaperone protein DnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1 20 82 1.0E-08
sp|O87778|DNAJ_LACSK Chaperone protein DnaJ OS=Lactobacillus sakei GN=dnaJ PE=2 SV=1 20 84 1.0E-08
sp|A8H759|DNAJ_SHEPA Chaperone protein DnaJ OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=dnaJ PE=3 SV=1 20 82 1.0E-08
sp|Q9KD71|DNAJ_BACHD Chaperone protein DnaJ OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dnaJ PE=3 SV=1 20 82 1.0E-08
sp|Q38W94|DNAJ_LACSS Chaperone protein DnaJ OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=dnaJ PE=3 SV=1 20 84 1.0E-08
sp|A7NS65|DNAJ_ROSCS Chaperone protein DnaJ OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=dnaJ PE=3 SV=1 20 82 1.0E-08
sp|Q67S53|DNAJ_SYMTH Chaperone protein DnaJ OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaJ PE=3 SV=1 20 82 1.0E-08
sp|Q9QYJ3|DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus GN=Dnajb1 PE=1 SV=3 20 84 1.0E-08
sp|B4S9D0|DNAJ_PROA2 Chaperone protein DnaJ OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=dnaJ PE=3 SV=1 20 92 1.0E-08
sp|B5YAR4|DNAJ_DICT6 Chaperone protein DnaJ OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=dnaJ PE=3 SV=1 16 104 1.0E-08
sp|Q6RSN5|DNAJ_RHIRD Chaperone protein DnaJ OS=Rhizobium radiobacter GN=dnaJ PE=1 SV=1 17 82 1.0E-08
sp|A6Q486|DNAJ_NITSB Chaperone protein DnaJ OS=Nitratiruptor sp. (strain SB155-2) GN=dnaJ PE=3 SV=1 20 93 1.0E-08
sp|Q87WP1|DNAJ_PSESM Chaperone protein DnaJ OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=dnaJ PE=3 SV=1 20 92 1.0E-08
sp|P22305|DNAJ_CAUCR Chaperone protein DnaJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaJ PE=3 SV=2 20 82 1.0E-08
sp|B8I304|DNAJ_CLOCE Chaperone protein DnaJ OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=dnaJ PE=3 SV=1 20 82 2.0E-08
sp|B0CAZ0|DNAJ_ACAM1 Chaperone protein DnaJ OS=Acaryochloris marina (strain MBIC 11017) GN=dnaJ PE=3 SV=1 20 90 2.0E-08
sp|Q5R6H3|DJB14_PONAB DnaJ homolog subfamily B member 14 OS=Pongo abelii GN=DNAJB14 PE=2 SV=1 13 82 2.0E-08
sp|A9IGC5|DNAJ_BORPD Chaperone protein DnaJ OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaJ PE=3 SV=1 20 89 2.0E-08
sp|Q8VXV4|DNJ16_ARATH Chaperone protein dnaJ 16 OS=Arabidopsis thaliana GN=ATJ16 PE=2 SV=1 21 83 2.0E-08
sp|B9DNJ9|DNAJ_STACT Chaperone protein DnaJ OS=Staphylococcus carnosus (strain TM300) GN=dnaJ PE=3 SV=1 20 82 2.0E-08
sp|Q24SS4|DNAJ_DESHY Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain Y51) GN=dnaJ PE=3 SV=1 20 82 2.0E-08
sp|B8FUN3|DNAJ_DESHD Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=dnaJ PE=3 SV=1 20 82 2.0E-08
sp|Q48E63|DNAJ_PSE14 Chaperone protein DnaJ OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=dnaJ PE=3 SV=1 20 89 2.0E-08
sp|Q4ZNP8|DNAJ_PSEU2 Chaperone protein DnaJ OS=Pseudomonas syringae pv. syringae (strain B728a) GN=dnaJ PE=3 SV=1 20 92 2.0E-08
sp|Q5NSW9|DNAJ_BURM1 Chaperone protein DnaJ OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaJ PE=3 SV=1 20 89 2.0E-08
sp|A7I2G3|DNAJ_CAMHC Chaperone protein DnaJ OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dnaJ PE=3 SV=1 20 92 2.0E-08
sp|Q83MZ4|DNAJ_TROWT Chaperone protein DnaJ OS=Tropheryma whipplei (strain Twist) GN=dnaJ PE=3 SV=1 20 137 2.0E-08
sp|Q97BG9|DNAJ_THEVO Chaperone protein DnaJ OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaJ PE=3 SV=1 20 93 2.0E-08
sp|Q7M9T3|DNAJ_WOLSU Chaperone protein DnaJ OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=dnaJ PE=3 SV=1 20 84 2.0E-08
sp|Q96KC8|DNJC1_HUMAN DnaJ homolog subfamily C member 1 OS=Homo sapiens GN=DNAJC1 PE=1 SV=1 20 119 2.0E-08
sp|A6WX07|DNAJ_OCHA4 Chaperone protein DnaJ OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=dnaJ PE=3 SV=1 20 82 2.0E-08
sp|B2UBP2|DNAJ_RALPJ Chaperone protein DnaJ OS=Ralstonia pickettii (strain 12J) GN=dnaJ PE=3 SV=1 20 89 2.0E-08
sp|A0AIS3|DNAJ_LISW6 Chaperone protein DnaJ OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaJ PE=3 SV=1 20 84 3.0E-08
sp|Q6A997|DNAJ1_PROAC Chaperone protein DnaJ 1 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=dnaJ1 PE=3 SV=1 20 86 3.0E-08
sp|A6WRU8|DNAJ_SHEB8 Chaperone protein DnaJ OS=Shewanella baltica (strain OS185) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|A3D7T3|DNAJ_SHEB5 Chaperone protein DnaJ OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|B8E4S2|DNAJ_SHEB2 Chaperone protein DnaJ OS=Shewanella baltica (strain OS223) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|Q2YT48|DNAJ_STAAB Chaperone protein DnaJ OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|A8F0U0|DNAJ_RICM5 Chaperone protein DnaJ OS=Rickettsia massiliae (strain Mtu5) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|A9L0R7|DNAJ_SHEB9 Chaperone protein DnaJ OS=Shewanella baltica (strain OS195) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|Q83NI2|DNAJ_TROW8 Chaperone protein DnaJ OS=Tropheryma whipplei (strain TW08/27) GN=dnaJ PE=3 SV=1 20 137 3.0E-08
sp|Q92J37|DNAJ_RICCN Chaperone protein DnaJ OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|C3PMM6|DNAJ_RICAE Chaperone protein DnaJ OS=Rickettsia africae (strain ESF-5) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|Q31HA6|DNAJ_THICR Chaperone protein DnaJ OS=Thiomicrospira crunogena (strain XCL-2) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|A9HEA1|DNAJ_GLUDA Chaperone protein DnaJ OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaJ PE=3 SV=1 15 82 3.0E-08
sp|P63972|DNAJ_STAAW Chaperone protein DnaJ OS=Staphylococcus aureus (strain MW2) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|A8Z4B8|DNAJ_STAAT Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|Q6G8Y8|DNAJ_STAAS Chaperone protein DnaJ OS=Staphylococcus aureus (strain MSSA476) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|P63971|DNAJ_STAAN Chaperone protein DnaJ OS=Staphylococcus aureus (strain N315) GN=dnaJ PE=1 SV=1 20 82 3.0E-08
sp|P63970|DNAJ_STAAM Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|A6QHC2|DNAJ_STAAE Chaperone protein DnaJ OS=Staphylococcus aureus (strain Newman) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|Q5HFI1|DNAJ_STAAC Chaperone protein DnaJ OS=Staphylococcus aureus (strain COL) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|A5ITA7|DNAJ_STAA9 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH9) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|Q2FXZ3|DNAJ_STAA8 Chaperone protein DnaJ OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|Q2FGE4|DNAJ_STAA3 Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|A6U251|DNAJ_STAA2 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH1) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|A7X2Y0|DNAJ_STAA1 Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|B3CVD9|DNAJ_ORITI Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Ikeda) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|Q9HJ83|DNAJ_THEAC Chaperone protein DnaJ OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|B2SXC7|DNAJ_BURPP Chaperone protein DnaJ OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaJ PE=3 SV=1 20 89 3.0E-08
sp|Q6GGC1|DNAJ_STAAR Chaperone protein DnaJ OS=Staphylococcus aureus (strain MRSA252) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
sp|Q752D7|DPH4_ASHGO Diphthamide biosynthesis protein 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPH4 PE=3 SV=1 21 93 3.0E-08
sp|Q39JC7|DNAJ_BURL3 Chaperone protein DnaJ OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dnaJ PE=3 SV=1 20 89 3.0E-08
sp|Q93Q66|DNAJ_LACLC Chaperone protein DnaJ OS=Lactococcus lactis subsp. cremoris GN=dnaJ PE=3 SV=1 20 87 3.0E-08
sp|Q145F0|DNAJ_BURXL Chaperone protein DnaJ OS=Burkholderia xenovorans (strain LB400) GN=dnaJ PE=3 SV=1 20 89 3.0E-08
sp|Q6G1F8|DNAJ_BARQU Chaperone protein DnaJ OS=Bartonella quintana (strain Toulouse) GN=dnaJ PE=3 SV=1 20 95 3.0E-08
sp|Q9HHB8|DNAJ_HALMT Chaperone protein DnaJ OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=dnaJ PE=3 SV=1 20 82 3.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5429
MASEQSSQRLSNLTSTKACFYDLLGVEPSATAHDVKRAYRKRALELHPDRNIRDVEAATAKFAEVQAAYDILSDP
NERTWYDSHYDAIISGSGEPSHIRKPAIFRNVHLTTTEEIFHLMRKFSASVPVDNRPANFFGLANSTFNRLALEE
KTATAELANVIIFEYPTFGLADDDYEGVVKYFYGVWEDFSTRKSFSWMDKHHPLEASDRRTRRILEKENGKRRAI
AIHEFNAAVRFLVDFLRKRDPRCISNAKMDAEHRKSVLDAVAAQSARSRAANRKKLATSQGPHWAKPKEGEEAEE
QLLFESSEESTVERSKCILCHKSFKSLNQLEAHERSKKHNKTVQELRQREGREGVKLRR*
Coding >Hirsu2|5429
ATGGCTTCAGAACAGTCATCTCAACGCTTATCCAACTTAACCTCTACGAAGGCATGCTTCTATGATCTCCTGGGT
GTGGAACCCAGTGCCACCGCCCATGACGTTAAGAGGGCCTATCGCAAACGTGCACTAGAGCTTCATCCAGATCGC
AACATTAGAGATGTTGAGGCTGCCACGGCAAAGTTTGCAGAAGTCCAAGCAGCTTACGACATTTTGTCTGACCCT
AACGAGCGAACTTGGTATGACTCCCACTACGACGCTATTATCAGTGGCTCGGGAGAACCCAGTCATATCAGGAAG
CCAGCTATCTTCCGCAATGTCCATTTGACGACTACCGAAGAGATATTCCACCTGATGCGAAAGTTCAGTGCGAGT
GTCCCTGTTGATAATCGGCCCGCCAACTTTTTTGGTCTTGCGAATTCAACGTTCAATCGCCTCGCTCTAGAAGAA
AAGACTGCGACCGCTGAGCTCGCCAACGTGATCATTTTTGAGTATCCAACGTTTGGTCTCGCTGATGATGATTAC
GAAGGTGTTGTGAAATACTTCTACGGCGTTTGGGAAGACTTTTCAACTCGGAAATCATTTTCGTGGATGGATAAG
CATCATCCATTGGAGGCCTCCGACCGCCGTACGCGTCGTATCTTAGAGAAGGAAAACGGAAAGCGTCGAGCCATC
GCAATTCATGAATTCAACGCGGCTGTCCGTTTCCTTGTCGACTTCCTCAGGAAACGTGACCCTCGTTGTATCTCA
AATGCAAAAATGGATGCAGAGCACCGCAAATCAGTACTTGATGCAGTAGCTGCACAATCTGCTCGCTCCCGTGCG
GCAAACAGAAAAAAATTAGCGACGAGTCAGGGGCCACACTGGGCAAAACCTAAGGAAGGCGAGGAGGCCGAGGAG
CAGCTTTTATTCGAATCTTCCGAGGAGTCGACTGTTGAGAGAAGCAAATGCATCCTTTGTCACAAGTCGTTCAAA
AGTCTGAACCAACTCGAGGCCCACGAGAGAAGTAAAAAGCATAATAAGACTGTTCAGGAGCTACGTCAACGAGAA
GGACGGGAGGGAGTAAAGTTGAGAAGATAG
Transcript >Hirsu2|5429
ATGGCTTCAGAACAGTCATCTCAACGCTTATCCAACTTAACCTCTACGAAGGCATGCTTCTATGATCTCCTGGGT
GTGGAACCCAGTGCCACCGCCCATGACGTTAAGAGGGCCTATCGCAAACGTGCACTAGAGCTTCATCCAGATCGC
AACATTAGAGATGTTGAGGCTGCCACGGCAAAGTTTGCAGAAGTCCAAGCAGCTTACGACATTTTGTCTGACCCT
AACGAGCGAACTTGGTATGACTCCCACTACGACGCTATTATCAGTGGCTCGGGAGAACCCAGTCATATCAGGAAG
CCAGCTATCTTCCGCAATGTCCATTTGACGACTACCGAAGAGATATTCCACCTGATGCGAAAGTTCAGTGCGAGT
GTCCCTGTTGATAATCGGCCCGCCAACTTTTTTGGTCTTGCGAATTCAACGTTCAATCGCCTCGCTCTAGAAGAA
AAGACTGCGACCGCTGAGCTCGCCAACGTGATCATTTTTGAGTATCCAACGTTTGGTCTCGCTGATGATGATTAC
GAAGGTGTTGTGAAATACTTCTACGGCGTTTGGGAAGACTTTTCAACTCGGAAATCATTTTCGTGGATGGATAAG
CATCATCCATTGGAGGCCTCCGACCGCCGTACGCGTCGTATCTTAGAGAAGGAAAACGGAAAGCGTCGAGCCATC
GCAATTCATGAATTCAACGCGGCTGTCCGTTTCCTTGTCGACTTCCTCAGGAAACGTGACCCTCGTTGTATCTCA
AATGCAAAAATGGATGCAGAGCACCGCAAATCAGTACTTGATGCAGTAGCTGCACAATCTGCTCGCTCCCGTGCG
GCAAACAGAAAAAAATTAGCGACGAGTCAGGGGCCACACTGGGCAAAACCTAAGGAAGGCGAGGAGGCCGAGGAG
CAGCTTTTATTCGAATCTTCCGAGGAGTCGACTGTTGAGAGAAGCAAATGCATCCTTTGTCACAAGTCGTTCAAA
AGTCTGAACCAACTCGAGGCCCACGAGAGAAGTAAAAAGCATAATAAGACTGTTCAGGAGCTACGTCAACGAGAA
GGACGGGAGGGAGTAAAGTTGAGAAGATAG
Gene >Hirsu2|5429
ATGGCTTCAGAACAGTCATCTCAACGCTTATCCAACTTAACCTCTACGAAGGCATGCTTCTATGATCTCCTGGGT
GTGGAACCCAGTGCCACCGCCCATGAGTGAGTGACGTTCCGGATTCATGCGAGACTGAAAACCATCTTACAGTTC
TTATTAGCGTTAAGAGGGCCTATCGCAAACGTGCACTAGAGCTTCATCCAGATCGCAACATTAGAGATGTTGAGG
CTGCCACGGCAAAGTTTGCAGAAGTCCAAGCAGCTTACGACATTTTGTCTGACCCTAACGAGCGAACTTGGTATG
ACTCCCACTACGACGCTATTATCAGTGGCTCGGGAGAACCCAGTCATATCAGGAAGCCAGCTATCTTCCGCAATG
TCCATTTGACGACTACCGAAGAGATATTCCACCTGATGCGAAAGTTCAGTGCGAGTGTCCCTGTTGATAATCGGC
CCGCCAACTTTTTTGGTCTTGCGAATTCAACGTTCAATCGCCTCGCTCTAGAAGAAAAGACTGCGACCGCTGAGC
TCGCCAACGTGATCATTTTTGAGTATCCAACGTTTGGTCTCGCTGATGATGATTACGAAGGTGTTGTGAAATACT
TCTACGGCGTTTGGGAAGACTTTTCAACTCGGAAATCATTTTCGTGGATGGATAAGCATCATCCATTGGAGGCCT
CCGACCGCCGTACGCGTCGTATCTTAGAGAAGGAAAACGGAAAGCGTCGAGCCATCGCAATTCATGAATTCAACG
CGGCTGTCCGTTTCCTTGTCGACTTCCTCAGGAAACGTGACCCTCGTTGTATCTCAAATGCAAAAATGGATGCAG
AGCACCGCAAATCAGTACTTGATGCAGTAGCTGCACAATCTGCTCGCTCCCGTGCGGCAAACAGAAAAAAATTAG
CGACGAGTCAGGGGCCACACTGGGCAAAACCTAAGGAAGGCGAGGAGGCCGAGGAGCAGCTTTTATTCGAATCTT
CCGAGGAGTCGACTGTTGAGAGAAGCAAATGCATCCTTTGTCACAAGTCGTTCAAAAGTCTGAACCAACTCGAGG
CCCACGAGAGAAGTAAAAAGCATAATAAGACTGTTCAGGAGCTACGTCAACGAGAAGGACGGGAGGGAGTAAAGT
TGAGAAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail