Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5422
Gene name
LocationContig_271:18037..20949
Strand-
Gene length (bp)2912
Transcript length (bp)2604
Coding sequence length (bp)2604
Protein length (aa) 868

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02898 NO_synthase Nitric oxide synthase, oxygenase domain 1.5E-72 2 303
PF00258 Flavodoxin_1 Flavodoxin 8.4E-08 366 462

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q06518|NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus GN=Nos2 PE=1 SV=2 2 471 1.0E-52
sp|Q90703|NOS2_CHICK Nitric oxide synthase, inducible OS=Gallus gallus GN=NOS2 PE=2 SV=1 2 471 4.0E-52
sp|Q27571|NOS_DROME Nitric oxide synthase OS=Drosophila melanogaster GN=Nos PE=2 SV=3 2 397 3.0E-51
sp|P29477|NOS2_MOUSE Nitric oxide synthase, inducible OS=Mus musculus GN=Nos2 PE=1 SV=1 2 471 5.0E-51
sp|O54705|NOS2_CAVPO Nitric oxide synthase, inducible OS=Cavia porcellus GN=NOS2 PE=2 SV=1 2 471 3.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q06518|NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus GN=Nos2 PE=1 SV=2 2 471 1.0E-52
sp|Q90703|NOS2_CHICK Nitric oxide synthase, inducible OS=Gallus gallus GN=NOS2 PE=2 SV=1 2 471 4.0E-52
sp|Q27571|NOS_DROME Nitric oxide synthase OS=Drosophila melanogaster GN=Nos PE=2 SV=3 2 397 3.0E-51
sp|P29477|NOS2_MOUSE Nitric oxide synthase, inducible OS=Mus musculus GN=Nos2 PE=1 SV=1 2 471 5.0E-51
sp|O54705|NOS2_CAVPO Nitric oxide synthase, inducible OS=Cavia porcellus GN=NOS2 PE=2 SV=1 2 471 3.0E-49
sp|O62699|NOS2_CANLF Nitric oxide synthase, inducible OS=Canis lupus familiaris GN=NOS2 PE=2 SV=2 2 471 7.0E-49
sp|O19132|NOS1_RABIT Nitric oxide synthase, brain OS=Oryctolagus cuniculus GN=NOS1 PE=2 SV=1 2 404 1.0E-48
sp|B1B557|NOSL_BOMMO Nitric oxide synthase-like protein OS=Bombyx mori GN=NSL PE=2 SV=1 2 297 2.0E-48
sp|P29475|NOS1_HUMAN Nitric oxide synthase, brain OS=Homo sapiens GN=NOS1 PE=1 SV=2 2 397 3.0E-48
sp|P35228|NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo sapiens GN=NOS2 PE=1 SV=2 2 471 4.0E-48
sp|Q9Z0J4|NOS1_MOUSE Nitric oxide synthase, brain OS=Mus musculus GN=Nos1 PE=1 SV=1 2 397 9.0E-48
sp|P70313|NOS3_MOUSE Nitric oxide synthase, endothelial OS=Mus musculus GN=Nos3 PE=1 SV=4 2 436 1.0E-47
sp|Q62600|NOS3_RAT Nitric oxide synthase, endothelial OS=Rattus norvegicus GN=Nos3 PE=1 SV=4 2 436 2.0E-47
sp|Q27995|NOS2_BOVIN Nitric oxide synthase, inducible OS=Bos taurus GN=NOS2 PE=2 SV=3 2 471 7.0E-47
sp|P29476|NOS1_RAT Nitric oxide synthase, brain OS=Rattus norvegicus GN=Nos1 PE=1 SV=1 2 397 8.0E-47
sp|Q28969|NOS3_PIG Nitric oxide synthase, endothelial OS=Sus scrofa GN=NOS3 PE=1 SV=4 2 436 1.0E-46
sp|P29473|NOS3_BOVIN Nitric oxide synthase, endothelial OS=Bos taurus GN=NOS3 PE=1 SV=3 2 436 1.0E-46
sp|O61608|NOS_ANOST Nitric oxide synthase OS=Anopheles stephensi PE=2 SV=2 2 397 1.0E-46
sp|P29474|NOS3_HUMAN Nitric oxide synthase, endothelial OS=Homo sapiens GN=NOS3 PE=1 SV=3 2 436 2.0E-46
sp|Q9TUX8|NOS3_CANLF Nitric oxide synthase, endothelial OS=Canis lupus familiaris GN=NOS3 PE=2 SV=1 2 436 1.0E-44
sp|O34453|NOSO_BACSU Nitric oxide synthase oxygenase OS=Bacillus subtilis (strain 168) GN=nos PE=1 SV=2 8 301 7.0E-44
sp|Q26240|NOS_RHOPR Nitric oxide synthase, salivary gland OS=Rhodnius prolixus PE=2 SV=1 2 397 1.0E-42
sp|Q8T8C0|NOS_BOMMO Nitric oxide synthase OS=Bombyx mori GN=NOS PE=2 SV=1 2 297 5.0E-41
sp|O61309|NOS_LYMST Nitric oxide synthase OS=Lymnaea stagnalis GN=NOS PE=2 SV=1 2 397 1.0E-40
sp|P79290|NOS2_PIG Nitric oxide synthase, inducible (Fragment) OS=Sus scrofa GN=NOS2 PE=2 SV=1 12 240 3.0E-38
sp|P0A094|NOSO_STAAW Nitric oxide synthase oxygenase OS=Staphylococcus aureus (strain MW2) GN=nos PE=3 SV=1 8 292 2.0E-33
sp|P0A004|NOSO_STAAU Nitric oxide synthase oxygenase OS=Staphylococcus aureus GN=nos PE=1 SV=1 8 292 2.0E-33
sp|Q6G818|NOSO_STAAS Nitric oxide synthase oxygenase OS=Staphylococcus aureus (strain MSSA476) GN=nos PE=3 SV=1 8 292 2.0E-33
sp|P0A093|NOSO_STAAN Nitric oxide synthase oxygenase OS=Staphylococcus aureus (strain N315) GN=nos PE=1 SV=1 8 292 2.0E-33
sp|P0A092|NOSO_STAAM Nitric oxide synthase oxygenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=nos PE=3 SV=1 8 292 2.0E-33
sp|Q5HEK7|NOSO_STAAC Nitric oxide synthase oxygenase OS=Staphylococcus aureus (strain COL) GN=nos PE=3 SV=1 8 292 2.0E-33
sp|Q6GFE2|NOSO_STAAR Nitric oxide synthase oxygenase OS=Staphylococcus aureus (strain MRSA252) GN=nos PE=3 SV=1 8 292 4.0E-33
sp|Q9RR97|NOSO_DEIRA Nitric oxide synthase oxygenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=nos PE=1 SV=1 2 291 4.0E-31
sp|Q92091|NOS2_ONCMY Nitric oxide synthase, inducible (Fragment) OS=Oncorhynchus mykiss GN=nos2 PE=2 SV=1 175 482 2.0E-15
sp|Q9Y8G7|C505_FUSOX Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 379 858 8.0E-12
sp|P57503|CYSJ_BUCAI Sulfite reductase [NADPH] flavoprotein alpha-component OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=cysJ PE=3 SV=1 340 833 2.0E-10
sp|Q1LTP1|CYSJ_BAUCH Sulfite reductase [NADPH] flavoprotein alpha-component OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=cysJ PE=3 SV=1 369 845 5.0E-10
sp|Q7N8L6|CYSJ_PHOLL Sulfite reductase [NADPH] flavoprotein alpha-component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysJ PE=3 SV=1 369 833 2.0E-09
sp|B1B557|NOSL_BOMMO Nitric oxide synthase-like protein OS=Bombyx mori GN=NSL PE=2 SV=1 673 843 5.0E-09
sp|Q5NRM1|CYSJ_ZYMMO Sulfite reductase [NADPH] flavoprotein alpha-component OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=cysJ PE=3 SV=1 369 846 3.0E-07
sp|Q5BB41|NDOR1_EMENI NADPH-dependent diflavin oxidoreductase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tah18 PE=3 SV=3 344 479 3.0E-06
sp|Q4WU59|NDOR1_ASPFU NADPH-dependent diflavin oxidoreductase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tah18 PE=3 SV=1 344 479 3.0E-06
sp|Q32CG3|CYSJ_SHIDS Sulfite reductase [NADPH] flavoprotein alpha-component OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cysJ PE=3 SV=1 369 861 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006809 nitric oxide biosynthetic process Yes
GO:0010181 FMN binding Yes
GO:0055114 oxidation-reduction process Yes
GO:0004517 nitric-oxide synthase activity Yes
GO:1903409 reactive oxygen species biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0050662 coenzyme binding No
GO:0016491 oxidoreductase activity No
GO:0048037 cofactor binding No
GO:0044237 cellular metabolic process No
GO:0065007 biological regulation No
GO:0097159 organic cyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0017144 drug metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0001505 regulation of neurotransmitter levels No
GO:0004497 monooxygenase activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0042136 neurotransmitter biosynthetic process No
GO:0046209 nitric oxide metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:2001057 reactive nitrogen species metabolic process No
GO:0009058 biosynthetic process No
GO:0072593 reactive oxygen species metabolic process No
GO:0042133 neurotransmitter metabolic process No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No
GO:0065008 regulation of biological quality No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5422
MRSEYAYLKLNDLRHLRTSKEMGQALVKGMCEAFNGGDIQPSVFVFPAKKPNSSGPMVWNQQFLAFAGYRQQDGS
VLGDPMNVSLTESIISLGWEPPAIRTRWDMLPLVTMADGDEPHITPFPESLFPLVHIRHPKPEHSLAFDKLGLRW
VPAPALSQLGFDIGGVQYTATPFIGWFMDAEIGVRDLADSFRYDVLPSVVSALKLLQPGQELDELPQWERLAHLS
RAQAELNFAVHWSFSEAGVRMSDSLTASAMYANFDDQHLAKHGFRLPADPYWLAPPQGSIIPMWHRGGAPNYQPK
PMICRLKENPVKVWKRLKACRNGIAPKANGVNGINGHAVNAVKLEQRLHIIMAQANEFESIKPAVPLNDCKIDAL
SAGDLVFIIASCAGRGDVPTNGLSMLNRCKSLARVEASGVSFCIFGNGNSSYGANFNGASVKLERALEQLGLSSA
LPSFQADTLKEDPPWRQFKTWLSHIEAKYGDFTENSEDSSTDSLDDSTGQLLAQLSPAKVLSVHGPKGGEIRRLA
LDVGRLEYGHMSHIDVFVPISDDEIDELLLAVRLTGEEMLSFEEGQVSTRQLLSLVDPDKPFKSLKWATKLGLML
GSDEEARLLSKPMRESIRGLPIGWQSKAKRSNLAEFMTALPTRRSRTFSTASSQLYWTTQNMGNVLELTLQKHLG
GLVTDHFLSKARRGGRLYVRIRHGPGAHLVNEQRPLVAFTTGSGIAPLRGLLQARSAIAADRPMESKTRDPKTGK
TVRGNPVSLFLGFRPGDTEIINETFHEAMALGLVDMVHLTPSNPAKDRAQDKIFQEGVASLIRTKIRDEGASVFV
CASKEAADDFARNLGAIVGVESIREALGERWVEEVYVYTEGW*
Coding >Hirsu2|5422
ATGAGGAGCGAATATGCCTATCTAAAGCTGAACGATCTGCGACATCTCCGAACAAGCAAAGAGATGGGTCAGGCG
CTAGTCAAGGGAATGTGTGAAGCCTTCAACGGAGGCGACATTCAGCCAAGCGTCTTCGTCTTTCCGGCCAAGAAA
CCCAATTCCTCTGGTCCTATGGTCTGGAACCAGCAGTTTCTGGCATTTGCAGGCTACCGCCAACAGGATGGGAGC
GTGCTCGGTGATCCCATGAACGTCAGCTTGACAGAGTCCATTATATCGCTGGGCTGGGAGCCTCCAGCCATCCGG
ACCCGCTGGGACATGCTTCCCCTGGTGACCATGGCAGACGGGGACGAGCCTCACATTACACCTTTCCCAGAGAGT
CTCTTCCCTCTAGTGCACATACGCCATCCCAAGCCAGAGCATTCCCTTGCTTTCGACAAACTAGGTCTTCGATGG
GTTCCCGCGCCGGCTTTATCGCAGTTAGGATTCGACATTGGTGGTGTGCAATACACTGCCACTCCATTCATCGGG
TGGTTCATGGACGCCGAAATCGGAGTTCGCGATCTTGCCGACAGCTTCCGATACGATGTATTGCCGTCTGTCGTC
TCGGCCCTGAAGCTCCTCCAGCCCGGCCAAGAGCTCGACGAGCTTCCACAGTGGGAGCGGCTCGCCCACCTGTCC
AGGGCACAGGCTGAACTGAATTTCGCCGTCCACTGGTCCTTCTCTGAGGCCGGCGTTCGCATGAGCGATAGTCTC
ACGGCCAGCGCCATGTATGCCAATTTTGACGACCAGCATCTTGCCAAGCACGGTTTTCGCCTCCCGGCGGACCCA
TACTGGCTGGCGCCTCCGCAGGGCAGCATCATTCCCATGTGGCATCGAGGTGGCGCTCCAAACTACCAGCCCAAG
CCCATGATCTGTCGGCTCAAAGAGAACCCGGTCAAGGTGTGGAAGAGGCTTAAGGCCTGCAGGAATGGCATCGCG
CCCAAGGCCAACGGAGTCAACGGCATCAACGGACATGCAGTCAACGCCGTCAAGTTGGAGCAAAGATTACACATC
ATCATGGCCCAAGCCAACGAGTTCGAGTCCATCAAACCCGCCGTTCCACTCAACGATTGCAAGATAGATGCGCTT
TCAGCCGGAGACCTTGTCTTCATCATCGCGAGCTGCGCCGGACGCGGGGACGTCCCCACAAACGGGCTCTCCATG
CTGAACCGGTGCAAGTCACTGGCCAGGGTTGAGGCCAGCGGCGTCTCCTTCTGCATCTTTGGTAATGGCAATTCC
TCTTACGGTGCGAACTTCAATGGCGCCTCCGTCAAGTTGGAGAGGGCGTTGGAGCAGCTCGGACTTTCGAGCGCC
CTGCCCTCGTTCCAAGCAGATACGCTGAAAGAGGATCCACCGTGGAGGCAGTTCAAGACATGGCTATCTCACATT
GAAGCCAAATATGGGGACTTTACAGAGAATTCGGAAGACTCTTCGACCGATTCCTTGGACGATTCAACGGGGCAG
CTGCTGGCTCAGCTTTCTCCAGCCAAGGTGCTCTCCGTTCACGGCCCCAAAGGCGGAGAAATTCGACGTCTTGCT
CTCGACGTCGGAAGGCTCGAATATGGCCATATGAGCCACATCGATGTGTTTGTGCCGATAAGTGATGACGAAATC
GACGAGCTGCTGCTGGCAGTCCGTCTCACTGGAGAGGAGATGCTCTCCTTTGAGGAGGGACAAGTTAGCACGAGG
CAGCTTTTGTCTCTTGTGGACCCGGATAAGCCGTTCAAGAGCCTTAAATGGGCTACCAAGCTGGGACTAATGCTG
GGAAGCGACGAGGAGGCCCGTCTGTTGAGCAAGCCCATGAGGGAATCCATCCGAGGCCTGCCGATCGGCTGGCAG
TCAAAGGCCAAGCGCAGTAATCTGGCGGAATTCATGACAGCTCTCCCGACCCGGCGTTCGAGAACGTTCTCTACG
GCCTCCTCGCAACTGTACTGGACCACGCAAAACATGGGCAACGTCCTAGAGCTGACGCTGCAGAAGCATTTGGGT
GGTCTCGTGACGGATCACTTTCTCTCCAAGGCCAGAAGAGGAGGACGTCTTTACGTGCGGATTCGCCACGGCCCG
GGTGCTCACCTGGTGAATGAGCAGAGACCGCTTGTTGCCTTCACAACCGGCTCCGGCATCGCACCCCTGAGGGGA
CTTTTGCAAGCCAGATCCGCAATTGCGGCCGATAGGCCAATGGAGAGCAAAACGAGGGACCCGAAAACGGGGAAG
ACGGTGCGCGGGAACCCGGTATCCCTGTTCCTCGGGTTCAGGCCAGGCGACACCGAAATAATCAACGAGACTTTT
CACGAAGCCATGGCACTAGGGCTGGTGGATATGGTGCATTTGACGCCAAGCAATCCGGCGAAGGACCGAGCTCAG
GACAAAATCTTCCAAGAAGGAGTGGCTAGTCTGATCAGGACGAAAATCCGCGACGAAGGAGCAAGTGTTTTTGTG
TGTGCATCGAAGGAGGCAGCCGATGACTTTGCGAGAAATCTAGGAGCCATCGTTGGGGTCGAATCCATCCGGGAG
GCTCTAGGGGAGAGATGGGTCGAGGAGGTTTACGTCTATACCGAAGGGTGGTGA
Transcript >Hirsu2|5422
ATGAGGAGCGAATATGCCTATCTAAAGCTGAACGATCTGCGACATCTCCGAACAAGCAAAGAGATGGGTCAGGCG
CTAGTCAAGGGAATGTGTGAAGCCTTCAACGGAGGCGACATTCAGCCAAGCGTCTTCGTCTTTCCGGCCAAGAAA
CCCAATTCCTCTGGTCCTATGGTCTGGAACCAGCAGTTTCTGGCATTTGCAGGCTACCGCCAACAGGATGGGAGC
GTGCTCGGTGATCCCATGAACGTCAGCTTGACAGAGTCCATTATATCGCTGGGCTGGGAGCCTCCAGCCATCCGG
ACCCGCTGGGACATGCTTCCCCTGGTGACCATGGCAGACGGGGACGAGCCTCACATTACACCTTTCCCAGAGAGT
CTCTTCCCTCTAGTGCACATACGCCATCCCAAGCCAGAGCATTCCCTTGCTTTCGACAAACTAGGTCTTCGATGG
GTTCCCGCGCCGGCTTTATCGCAGTTAGGATTCGACATTGGTGGTGTGCAATACACTGCCACTCCATTCATCGGG
TGGTTCATGGACGCCGAAATCGGAGTTCGCGATCTTGCCGACAGCTTCCGATACGATGTATTGCCGTCTGTCGTC
TCGGCCCTGAAGCTCCTCCAGCCCGGCCAAGAGCTCGACGAGCTTCCACAGTGGGAGCGGCTCGCCCACCTGTCC
AGGGCACAGGCTGAACTGAATTTCGCCGTCCACTGGTCCTTCTCTGAGGCCGGCGTTCGCATGAGCGATAGTCTC
ACGGCCAGCGCCATGTATGCCAATTTTGACGACCAGCATCTTGCCAAGCACGGTTTTCGCCTCCCGGCGGACCCA
TACTGGCTGGCGCCTCCGCAGGGCAGCATCATTCCCATGTGGCATCGAGGTGGCGCTCCAAACTACCAGCCCAAG
CCCATGATCTGTCGGCTCAAAGAGAACCCGGTCAAGGTGTGGAAGAGGCTTAAGGCCTGCAGGAATGGCATCGCG
CCCAAGGCCAACGGAGTCAACGGCATCAACGGACATGCAGTCAACGCCGTCAAGTTGGAGCAAAGATTACACATC
ATCATGGCCCAAGCCAACGAGTTCGAGTCCATCAAACCCGCCGTTCCACTCAACGATTGCAAGATAGATGCGCTT
TCAGCCGGAGACCTTGTCTTCATCATCGCGAGCTGCGCCGGACGCGGGGACGTCCCCACAAACGGGCTCTCCATG
CTGAACCGGTGCAAGTCACTGGCCAGGGTTGAGGCCAGCGGCGTCTCCTTCTGCATCTTTGGTAATGGCAATTCC
TCTTACGGTGCGAACTTCAATGGCGCCTCCGTCAAGTTGGAGAGGGCGTTGGAGCAGCTCGGACTTTCGAGCGCC
CTGCCCTCGTTCCAAGCAGATACGCTGAAAGAGGATCCACCGTGGAGGCAGTTCAAGACATGGCTATCTCACATT
GAAGCCAAATATGGGGACTTTACAGAGAATTCGGAAGACTCTTCGACCGATTCCTTGGACGATTCAACGGGGCAG
CTGCTGGCTCAGCTTTCTCCAGCCAAGGTGCTCTCCGTTCACGGCCCCAAAGGCGGAGAAATTCGACGTCTTGCT
CTCGACGTCGGAAGGCTCGAATATGGCCATATGAGCCACATCGATGTGTTTGTGCCGATAAGTGATGACGAAATC
GACGAGCTGCTGCTGGCAGTCCGTCTCACTGGAGAGGAGATGCTCTCCTTTGAGGAGGGACAAGTTAGCACGAGG
CAGCTTTTGTCTCTTGTGGACCCGGATAAGCCGTTCAAGAGCCTTAAATGGGCTACCAAGCTGGGACTAATGCTG
GGAAGCGACGAGGAGGCCCGTCTGTTGAGCAAGCCCATGAGGGAATCCATCCGAGGCCTGCCGATCGGCTGGCAG
TCAAAGGCCAAGCGCAGTAATCTGGCGGAATTCATGACAGCTCTCCCGACCCGGCGTTCGAGAACGTTCTCTACG
GCCTCCTCGCAACTGTACTGGACCACGCAAAACATGGGCAACGTCCTAGAGCTGACGCTGCAGAAGCATTTGGGT
GGTCTCGTGACGGATCACTTTCTCTCCAAGGCCAGAAGAGGAGGACGTCTTTACGTGCGGATTCGCCACGGCCCG
GGTGCTCACCTGGTGAATGAGCAGAGACCGCTTGTTGCCTTCACAACCGGCTCCGGCATCGCACCCCTGAGGGGA
CTTTTGCAAGCCAGATCCGCAATTGCGGCCGATAGGCCAATGGAGAGCAAAACGAGGGACCCGAAAACGGGGAAG
ACGGTGCGCGGGAACCCGGTATCCCTGTTCCTCGGGTTCAGGCCAGGCGACACCGAAATAATCAACGAGACTTTT
CACGAAGCCATGGCACTAGGGCTGGTGGATATGGTGCATTTGACGCCAAGCAATCCGGCGAAGGACCGAGCTCAG
GACAAAATCTTCCAAGAAGGAGTGGCTAGTCTGATCAGGACGAAAATCCGCGACGAAGGAGCAAGTGTTTTTGTG
TGTGCATCGAAGGAGGCAGCCGATGACTTTGCGAGAAATCTAGGAGCCATCGTTGGGGTCGAATCCATCCGGGAG
GCTCTAGGGGAGAGATGGGTCGAGGAGGTTTACGTCTATACCGAAGGGTGGTGA
Gene >Hirsu2|5422
ATGAGGAGCGAATATGCCTATCTAAAGTATGTAACCCCTGCACACTTCAAGTCCATTGACTTGACCGCTCGTTTT
CACAATGTATCTTCAAACATTTGCTAACTTGTTTCACGTGGCAGGCTGAACGATCTGCGACATCTCCGAACAAGC
AAAGAGATGGGTCAGGCGCTAGTCAAGGGAATGTGTGAAGCCTTCAACGGAGGCGACATTCAGCCAAGCGGTATG
CGCCATATTTCCGCTGCCACCACACCTAGAGTCGGGCCAATTGTCACTAACAAACCCCATCAGTCTTCGTCTTTC
CGGCCAAGAAACCCAATTCCTCTGGTCCTATGGTCTGGAACCAGCAGTTTCTGGCATTTGCAGGCTACCGCCAAC
AGGATGGGAGCGTGCTCGGTGATCCCATGAACGTCAGCTTGACAGAGTCCATTATATCGCTGGGCTGGGAGCCTC
CAGCCATCCGGACCCGCTGGGACATGCTTCCCCTGGTGACCATGGCAGACGGGGACGAGCCTCACATTACACCTT
TCCCAGAGAGTCTCTTCCCTCTAGTGCACATACGCCATCCCAAGCCAGAGCATTCCCTTGCTTTCGACAAACTAG
GTCTTCGATGGGTTCCCGCGCCGGCTTTATCGCAGTTAGGATTCGACATTGGTGGTGTGCAATACACTGCCACTC
CATTCATCGGGTGGTTCATGGACGCCGAAATCGGAGTTCGCGATCTTGCCGACAGCTTCCGATACGATGTATTGC
CGTCTGTCGTCTCGGCCCTGAAGCTCCTCCAGCCCGGCCAAGAGCTCGACGAGCTTCCACAGTGGGAGCGGCTCG
CCCACCTGTCCAGGGCACAGGCTGAACTGAATTTCGCCGTCCACTGGTCCTTCTCTGAGGCCGGCGTTCGCATGA
GCGATAGTCTCACGGCCAGCGCCATGTATGCCAATTTTGACGACCAGCATCTTGCCAAGCACGGTTTTCGCCTCC
CGGCGGACCCATACTGGCTGGCGCCTCCGCAGGGCAGCATCATTCCCATGTGGCATCGAGGTGGCGCTCCAAACT
ACCAGCCCAAGCCCATGATCTGTCGGCTCAAAGAGAACCCGGTCAAGGTGTGGAAGAGGCTTAAGGCCTGCAGGA
ATGGCATCGCGCCCAAGGCCAACGGAGTCAACGGCATCAACGGACATGCAGTCAACGGTATGAATGGTGTGTGTC
CCGCCAGTGGCCACATCCAGGAACACAGAGGCAGTTTCGCACTCTGCCCTGCATTGAGCAACCGCGGTGTTTCAG
GGCCCGCGATTCATGTTTTCTACTGCAGCGCGGGCACCACTGCTCAACGTTTAGCCGTCAAGTTGGAGCAAAGAT
TACACATCATCATGGCCCAAGCCAACGAGTTCGAGTCCATCAAACCCGCCGTTCCACTCAACGATTGCAAGATAG
ATGCGCTTTCAGCCGGAGACCTTGTCTTCATCATCGCGAGCTGCGCCGGACGCGGGGACGTCCCCACAAACGGGC
TCTCCATGCTGAACCGGTGCAAGTCACTGGCCAGGGTTGAGGCCAGCGGCGTCTCCTTCTGCATCTTTGGTAATG
GCAATTCCTCTTACGGTGCGAACTTCAATGGCGCCTCCGTCAAGTTGGAGAGGGCGTTGGAGCAGCTCGGACTTT
CGAGCGCCCTGCCCTCGTTCCAAGCAGATACGCTGAAAGAGGATCCACCGTGGAGGCAGTTCAAGACATGGCTAT
CTCACATTGAAGCCAAATATGGGGACTTTACAGAGAATTCGGAAGACTCTTCGACCGATTCCTTGGACGATTCAA
CGGGGCAGCTGCTGGCTCAGCTTTCTCCAGCCAAGGTGCTCTCCGTTCACGGCCCCAAAGGCGGAGAAATTCGAC
GTCTTGCTCTCGACGTCGGAAGGCTCGAATATGGCCATATGAGCCACATCGATGTGTTTGTGCCGATAAGTGATG
ACGAAATCGACGAGCTGCTGCTGGCAGTCCGTCTCACTGGAGAGGAGATGCTCTCCTTTGAGGAGGGACAAGTTA
GCACGAGGCAGCTTTTGTCTCTTGTGGACCCGGATAAGCCGTTCAAGAGCCTTAAATGGGCTACCAAGCTGGGAC
TAATGCTGGGAAGCGACGAGGAGGCCCGTCTGTTGAGCAAGCCCATGAGGGAATCCATCCGAGGCCTGCCGATCG
GCTGGCAGTCAAAGGCCAAGCGCAGTAATCTGGCGGAATTCATGACAGCTCTCCCGACCCGGCGTTCGAGAACGT
TCTCTACGGCCTCCTCGCAACTGTACTGGACCACGCAAAACATGGGCAACGTCCTAGAGCTGACGCTGCAGAAGC
ATTTGGGTGGTCTCGTGACGGATCACTTTCTCTCCAAGGCCAGAAGAGGAGGACGTCTTTACGTGCGGATTCGCC
ACGGCCCGGGTGCTCACCTGGTGAATGAGCAGAGACCGCTTGTTGCCTTCACAACCGGCTCCGGCATCGCACCCC
TGAGGGGACTTTTGCAAGCCAGATCCGCAATTGCGGCCGATAGGCCAATGGAGAGCAAAACGAGGGACCCGAAAA
CGGGGAAGACGGTGCGCGGGAACCCGGTATCCCTGTTCCTCGGGTTCAGGCCAGGCGACACCGAAATAATCAACG
AGACTTTTCACGAAGCCATGGCACTAGGGCTGGTGGATATGGTGCATTTGACGCCAAGCAATCCGGCGAAGGACC
GAGCTCAGGACAAAATCTTCCAAGAAGGAGTGGCTAGTCTGATCAGGACGAAAATCCGCGACGAAGGAGCAAGTG
TTTTTGTGTGTGCATCGAAGGAGGCAGCCGATGACTTTGCGAGAAATCTAGGAGCCATCGTTGGGGTCGAATCCA
TCCGGGAGGCTCTAGGGGAGAGATGGGTCGAGGAGGTTTACGTCTATACCGAAGGGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail