© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|5414 |
| Gene name | |
| Location | Contig_2706:787..2053 |
| Strand | - |
| Gene length (bp) | 1266 |
| Transcript length (bp) | 1206 |
| Coding sequence length (bp) | 1206 |
| Protein length (aa) | 402 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00067 | p450 | Cytochrome P450 | 6.5E-25 | 18 | 274 |
| PF00067 | p450 | Cytochrome P450 | 4.0E-09 | 310 | 375 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P79152|CP3AJ_CAPHE | Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 | 171 | 377 | 2.0E-18 |
| sp|Q9ASR3|C7091_ARATH | Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 | 115 | 371 | 4.0E-18 |
| sp|Q27589|CP4D2_DROME | Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 | 164 | 374 | 1.0E-17 |
| sp|Q64417|CP3AE_CAVPO | Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 | 171 | 377 | 1.0E-17 |
| sp|Q64406|CP3AF_CAVPO | Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 | 171 | 377 | 1.0E-17 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P79152|CP3AJ_CAPHE | Cytochrome P450 3A19 (Fragment) OS=Capra hircus aegagrus GN=CYP3A19 PE=2 SV=1 | 171 | 377 | 2.0E-18 |
| sp|Q9ASR3|C7091_ARATH | Cytochrome P450 709B1 OS=Arabidopsis thaliana GN=CYP709B1 PE=2 SV=1 | 115 | 371 | 4.0E-18 |
| sp|Q27589|CP4D2_DROME | Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 | 164 | 374 | 1.0E-17 |
| sp|Q64417|CP3AE_CAVPO | Cytochrome P450 3A14 OS=Cavia porcellus GN=CYP3A14 PE=2 SV=2 | 171 | 377 | 1.0E-17 |
| sp|Q64406|CP3AF_CAVPO | Cytochrome P450 3A15 OS=Cavia porcellus GN=CYP3A15 PE=2 SV=1 | 171 | 377 | 1.0E-17 |
| sp|Q29496|CP3AO_SHEEP | Cytochrome P450 3A24 OS=Ovis aries GN=CYP3A24 PE=2 SV=1 | 171 | 377 | 5.0E-17 |
| sp|Q64481|CP3AG_MOUSE | Cytochrome P450 3A16 OS=Mus musculus GN=Cyp3a16 PE=2 SV=2 | 171 | 377 | 1.0E-16 |
| sp|O46051|C4D14_DROME | Probable cytochrome P450 4d14 OS=Drosophila melanogaster GN=Cyp4d14 PE=3 SV=1 | 164 | 376 | 1.0E-16 |
| sp|P79102|CP3AS_BOVIN | Cytochrome P450 3A28 OS=Bos taurus GN=CYP3A28 PE=2 SV=1 | 171 | 377 | 1.0E-16 |
| sp|Q64459|CP3AB_MOUSE | Cytochrome P450 3A11 OS=Mus musculus GN=Cyp3a11 PE=1 SV=1 | 171 | 377 | 2.0E-16 |
| sp|Q64409|CP3AH_CAVPO | Cytochrome P450 3A17 OS=Cavia porcellus GN=CYP3A17 PE=2 SV=1 | 171 | 371 | 3.0E-16 |
| sp|Q50EK3|C04C1_PINTA | Cytochrome P450 704C1 OS=Pinus taeda GN=CYP704C1 PE=2 SV=1 | 154 | 374 | 7.0E-16 |
| sp|P15540|CP21A_PIG | Steroid 21-hydroxylase OS=Sus scrofa GN=CYP21 PE=1 SV=2 | 13 | 378 | 7.0E-16 |
| sp|O35084|CP27B_MOUSE | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27b1 PE=2 SV=2 | 33 | 378 | 8.0E-16 |
| sp|O15528|CP27B_HUMAN | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27B1 PE=1 SV=1 | 33 | 373 | 8.0E-16 |
| sp|P20815|CP3A5_HUMAN | Cytochrome P450 3A5 OS=Homo sapiens GN=CYP3A5 PE=1 SV=1 | 171 | 377 | 1.0E-15 |
| sp|F4IK45|C70B2_ARATH | Cytochrome P450 709B2 OS=Arabidopsis thaliana GN=CYP709B2 PE=2 SV=1 | 164 | 372 | 1.0E-15 |
| sp|Q9T093|C70B3_ARATH | Cytochrome P450 709B3 OS=Arabidopsis thaliana GN=CYP709B3 PE=2 SV=1 | 115 | 369 | 2.0E-15 |
| sp|Q27606|CP4E2_DROME | Cytochrome P450 4e2 OS=Drosophila melanogaster GN=Cyp4e2 PE=2 SV=2 | 134 | 391 | 2.0E-15 |
| sp|P05183|CP3A2_RAT | Cytochrome P450 3A2 OS=Rattus norvegicus GN=Cyp3a2 PE=1 SV=2 | 171 | 377 | 2.0E-15 |
| sp|P04800|CP3A1_RAT | Cytochrome P450 3A1 OS=Rattus norvegicus GN=Cyp3a1 PE=1 SV=1 | 171 | 377 | 2.0E-15 |
| sp|O46054|C4AE1_DROME | Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 | 164 | 374 | 3.0E-15 |
| sp|O70537|CP3AV_MESAU | Cytochrome P450 3A31 OS=Mesocricetus auratus GN=CYP3A31 PE=2 SV=1 | 171 | 377 | 5.0E-15 |
| sp|Q27513|C13A4_CAEEL | Putative cytochrome P450 CYP13A4 OS=Caenorhabditis elegans GN=cyp-13A4 PE=3 SV=1 | 166 | 377 | 7.0E-15 |
| sp|Q27519|C13A7_CAEEL | Putative cytochrome P450 CYP13A7 OS=Caenorhabditis elegans GN=cyp-13A7 PE=3 SV=1 | 166 | 378 | 7.0E-15 |
| sp|Q92045|CP11A_DASAM | Cholesterol side-chain cleavage enzyme, mitochondrial (Fragment) OS=Dasyatis americana GN=CYP11A1 PE=2 SV=1 | 164 | 377 | 7.0E-15 |
| sp|O09158|CP3AP_MOUSE | Cytochrome P450 3A25 OS=Mus musculus GN=Cyp3a25 PE=1 SV=1 | 171 | 377 | 1.0E-14 |
| sp|Q9SHG5|C72C1_ARATH | Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 | 166 | 372 | 1.0E-14 |
| sp|Q9JMA7|CP341_MOUSE | Cytochrome P450 3A41 OS=Mus musculus GN=Cyp3a41a PE=1 SV=2 | 171 | 377 | 1.0E-14 |
| sp|O35132|CP27B_RAT | 25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27b1 PE=2 SV=2 | 33 | 398 | 1.0E-14 |
| sp|P82712|CCD1P_DROME | Probable cytochrome P450 12d1 proximal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-p PE=2 SV=3 | 117 | 369 | 1.0E-14 |
| sp|Q9FVS9|C96AF_ARATH | Alkane hydroxylase MAH1 OS=Arabidopsis thaliana GN=CYP96A15 PE=2 SV=1 | 164 | 375 | 1.0E-14 |
| sp|B5BSX1|BAMO_GLYUR | Beta-amyrin 11-oxidase OS=Glycyrrhiza uralensis GN=CYP88D6 PE=1 SV=1 | 164 | 375 | 1.0E-14 |
| sp|Q7KR10|CCD1D_DROME | Probable cytochrome P450 12d1 distal, mitochondrial OS=Drosophila melanogaster GN=Cyp12d1-d PE=2 SV=1 | 117 | 369 | 2.0E-14 |
| sp|P08684|CP3A4_HUMAN | Cytochrome P450 3A4 OS=Homo sapiens GN=CYP3A4 PE=1 SV=4 | 171 | 377 | 2.0E-14 |
| sp|Q9VXY0|CP4S3_DROME | Probable cytochrome P450 4s3 OS=Drosophila melanogaster GN=Cyp4s3 PE=3 SV=1 | 164 | 373 | 2.0E-14 |
| sp|P24463|CP3AC_CANLF | Cytochrome P450 3A12 OS=Canis lupus familiaris GN=CYP3A12 PE=2 SV=1 | 171 | 377 | 2.0E-14 |
| sp|Q9DBW0|CP4V2_MOUSE | Cytochrome P450 4V2 OS=Mus musculus GN=Cyp4v2 PE=1 SV=1 | 164 | 369 | 2.0E-14 |
| sp|A2RRT9|CP4V2_RAT | Cytochrome P450 4V2 OS=Rattus norvegicus GN=Cyp4v2 PE=2 SV=1 | 164 | 369 | 3.0E-14 |
| sp|Q964T1|CP4CU_BLAGE | Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 | 164 | 391 | 3.0E-14 |
| sp|Q64581|CP3AI_RAT | Cytochrome P450 3A18 OS=Rattus norvegicus GN=Cyp3a18 PE=2 SV=1 | 171 | 377 | 3.0E-14 |
| sp|Q9LUC8|C7A13_ARATH | Cytochrome P450 72A13 OS=Arabidopsis thaliana GN=CYP72A13 PE=2 SV=1 | 164 | 372 | 4.0E-14 |
| sp|O18809|CP2F3_CAPHI | Cytochrome P450 2F3 OS=Capra hircus GN=CYP2F3 PE=2 SV=1 | 90 | 392 | 4.0E-14 |
| sp|P33267|CP2F2_MOUSE | Cytochrome P450 2F2 OS=Mus musculus GN=Cyp2f2 PE=1 SV=1 | 147 | 392 | 5.0E-14 |
| sp|Q9VE01|C12A5_DROME | Probable cytochrome P450 12a5, mitochondrial OS=Drosophila melanogaster GN=Cyp12a5 PE=2 SV=1 | 136 | 393 | 9.0E-14 |
| sp|Q27514|C13A5_CAEEL | Putative cytochrome P450 CYP13A5 OS=Caenorhabditis elegans GN=cyp-13A5 PE=3 SV=1 | 166 | 372 | 9.0E-14 |
| sp|O48786|C734A_ARATH | Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 | 164 | 371 | 9.0E-14 |
| sp|P33268|CP3A8_MACFA | Cytochrome P450 3A8 OS=Macaca fascicularis GN=CYP3A8 PE=1 SV=1 | 171 | 377 | 1.0E-13 |
| sp|Q55AJ4|C516B_DICDI | Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 | 84 | 376 | 1.0E-13 |
| sp|Q9QUJ1|CP2DS_MESAU | Cytochrome P450 2D28 OS=Mesocricetus auratus GN=CYP2D28A PE=2 SV=1 | 147 | 371 | 1.0E-13 |
| sp|Q64464|CP3AD_MOUSE | Cytochrome P450 3A13 OS=Mus musculus GN=Cyp3a13 PE=1 SV=1 | 171 | 377 | 2.0E-13 |
| sp|P30608|CP52F_CANTR | Cytochrome P450 52A6 OS=Candida tropicalis GN=CYP52A6 PE=2 SV=1 | 163 | 369 | 2.0E-13 |
| sp|C0SJS3|ANGS_PASSA | Angelicin synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ4 PE=1 SV=1 | 151 | 371 | 2.0E-13 |
| sp|P27786|CP17A_MOUSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mus musculus GN=Cyp17a1 PE=1 SV=1 | 45 | 396 | 2.0E-13 |
| sp|P51538|CP3A9_RAT | Cytochrome P450 3A9 OS=Rattus norvegicus GN=Cyp3a9 PE=2 SV=2 | 171 | 377 | 2.0E-13 |
| sp|P48421|C83A1_ARATH | Cytochrome P450 83A1 OS=Arabidopsis thaliana GN=CYP83A1 PE=1 SV=2 | 156 | 371 | 2.0E-13 |
| sp|Q6ZWL3|CP4V2_HUMAN | Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 | 164 | 369 | 2.0E-13 |
| sp|P00191|CP21A_BOVIN | Steroid 21-hydroxylase OS=Bos taurus GN=CYP21 PE=1 SV=2 | 164 | 373 | 2.0E-13 |
| sp|Q9VL92|CP4E3_DROME | Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 | 164 | 376 | 2.0E-13 |
| sp|D4AY62|A1131_ARTBC | Cytochrome P450 ARB_01131 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01131 PE=3 SV=1 | 163 | 377 | 4.0E-13 |
| sp|Q5RCN6|CP4V2_PONAB | Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 | 164 | 369 | 4.0E-13 |
| sp|P08686|CP21A_HUMAN | Steroid 21-hydroxylase OS=Homo sapiens GN=CYP21A2 PE=1 SV=1 | 172 | 378 | 6.0E-13 |
| sp|Q9VVN6|CP312_DROME | Probable cytochrome P450 312a1 OS=Drosophila melanogaster GN=Cyp312a1 PE=2 SV=1 | 164 | 376 | 6.0E-13 |
| sp|P33269|CP4D1_DROME | Cytochrome P450 4d1 OS=Drosophila melanogaster GN=Cyp4d1 PE=2 SV=2 | 164 | 377 | 7.0E-13 |
| sp|O18993|CP3AL_CALJA | Cytochrome P450 3A21 OS=Callithrix jacchus GN=CYP3A21 PE=2 SV=1 | 171 | 377 | 7.0E-13 |
| sp|Q9V7G5|C4AA1_DROME | Probable cytochrome P450 4aa1 OS=Drosophila melanogaster GN=Cyp4aa1 PE=2 SV=2 | 103 | 374 | 7.0E-13 |
| sp|P10635|CP2D6_HUMAN | Cytochrome P450 2D6 OS=Homo sapiens GN=CYP2D6 PE=1 SV=2 | 147 | 371 | 7.0E-13 |
| sp|P13108|CP2D4_RAT | Cytochrome P450 2D4 OS=Rattus norvegicus GN=Cyp2d4 PE=2 SV=2 | 147 | 371 | 7.0E-13 |
| sp|O16805|CP4D1_DROSI | Cytochrome P450 4d1 OS=Drosophila simulans GN=Cyp4d1 PE=3 SV=1 | 164 | 377 | 8.0E-13 |
| sp|Q9W011|C4D20_DROME | Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 | 111 | 378 | 9.0E-13 |
| sp|Q2LA60|CP21A_FELCA | Steroid 21-hydroxylase OS=Felis catus GN=CYP21 PE=3 SV=1 | 164 | 373 | 9.0E-13 |
| sp|Q2LA59|CP21A_LYNLY | Steroid 21-hydroxylase OS=Lynx lynx GN=CYP21 PE=3 SV=1 | 164 | 373 | 1.0E-12 |
| sp|O64638|C76C3_ARATH | Cytochrome P450 76C3 OS=Arabidopsis thaliana GN=CYP76C3 PE=2 SV=2 | 164 | 369 | 1.0E-12 |
| sp|Q64148|CP3AA_MESAU | Lithocholate 6-beta-hydroxylase OS=Mesocricetus auratus GN=CYP3A10 PE=1 SV=2 | 171 | 392 | 1.0E-12 |
| sp|Q93VK5|LUT5_ARATH | Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 | 158 | 371 | 1.0E-12 |
| sp|P24462|CP3A7_HUMAN | Cytochrome P450 3A7 OS=Homo sapiens GN=CYP3A7 PE=1 SV=2 | 171 | 377 | 1.0E-12 |
| sp|Q9LUC6|C7A14_ARATH | Cytochrome P450 72A14 OS=Arabidopsis thaliana GN=CYP72A14 PE=2 SV=1 | 164 | 372 | 1.0E-12 |
| sp|Q9VVR9|C12C1_DROME | Probable cytochrome P450 12c1, mitochondrial OS=Drosophila melanogaster GN=Cyp12c1 PE=2 SV=2 | 118 | 369 | 2.0E-12 |
| sp|Q9HB55|CP343_HUMAN | Cytochrome P450 3A43 OS=Homo sapiens GN=CYP3A43 PE=1 SV=1 | 172 | 391 | 2.0E-12 |
| sp|Q27517|C13A3_CAEEL | Putative cytochrome P450 CYP13A3 OS=Caenorhabditis elegans GN=cyp-13A3 PE=3 SV=1 | 166 | 377 | 2.0E-12 |
| sp|Q64680|CP2DI_RAT | Cytochrome P450 2D18 OS=Rattus norvegicus GN=Cyp2d18 PE=2 SV=1 | 147 | 371 | 2.0E-12 |
| sp|Q9LUC5|C7A15_ARATH | Cytochrome P450 72A15 OS=Arabidopsis thaliana GN=CYP72A15 PE=2 SV=1 | 164 | 372 | 3.0E-12 |
| sp|Q9HCS2|CP4FC_HUMAN | Cytochrome P450 4F12 OS=Homo sapiens GN=CYP4F12 PE=1 SV=2 | 164 | 373 | 3.0E-12 |
| sp|P24461|CP2G1_RABIT | Cytochrome P450 2G1 OS=Oryctolagus cuniculus GN=CYP2G1 PE=1 SV=1 | 147 | 374 | 3.0E-12 |
| sp|H1A981|C7263_MEDTR | 11-oxo-beta-amyrin 30-oxidase OS=Medicago truncatula GN=CYP72A63 PE=1 SV=1 | 164 | 372 | 3.0E-12 |
| sp|P11715|CP17A_RAT | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Rattus norvegicus GN=Cyp17a1 PE=1 SV=2 | 45 | 376 | 3.0E-12 |
| sp|Q2XNC9|CP2D6_PANPA | Cytochrome P450 2D6 OS=Pan paniscus GN=CYP2D6 PE=3 SV=1 | 147 | 371 | 3.0E-12 |
| sp|Q05047|C72A1_CATRO | Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 | 171 | 372 | 4.0E-12 |
| sp|P10634|CP2DQ_RAT | Cytochrome P450 2D26 OS=Rattus norvegicus GN=Cyp2d26 PE=1 SV=2 | 147 | 371 | 4.0E-12 |
| sp|P08682|CP2E1_RABIT | Cytochrome P450 2E1 OS=Oryctolagus cuniculus GN=CYP2E1 PE=2 SV=2 | 111 | 396 | 4.0E-12 |
| sp|P11509|CP2A6_HUMAN | Cytochrome P450 2A6 OS=Homo sapiens GN=CYP2A6 PE=1 SV=3 | 139 | 369 | 4.0E-12 |
| sp|P12394|CP17A_CHICK | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Gallus gallus GN=CYP17A1 PE=2 SV=1 | 24 | 382 | 4.0E-12 |
| sp|Q2LCM1|CP21A_CANLU | Steroid 21-hydroxylase OS=Canis lupus GN=CYP21 PE=3 SV=1 | 13 | 373 | 4.0E-12 |
| sp|Q8WNW0|CP21A_CANLF | Steroid 21-hydroxylase OS=Canis lupus familiaris GN=CYP21 PE=3 SV=1 | 13 | 373 | 4.0E-12 |
| sp|Q9V4T3|C4AD1_DROME | Probable cytochrome P450 4ad1 OS=Drosophila melanogaster GN=Cyp4ad1 PE=2 SV=1 | 78 | 380 | 5.0E-12 |
| sp|Q3MID2|CP4F3_RAT | Leukotriene-B(4) omega-hydroxylase 2 OS=Rattus norvegicus GN=Cyp4f3 PE=2 SV=1 | 164 | 376 | 5.0E-12 |
| sp|Q29488|CP2DH_MACFA | Cytochrome P450 2D17 OS=Macaca fascicularis GN=CYP2D17 PE=2 SV=1 | 147 | 371 | 5.0E-12 |
| sp|Q82IY3|PTLI_STRAW | Pentalenene oxygenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlI PE=1 SV=1 | 121 | 373 | 5.0E-12 |
| sp|Q27518|C13A2_CAEEL | Putative cytochrome P450 CYP13A2 OS=Caenorhabditis elegans GN=cyp-13A2 PE=3 SV=1 | 166 | 399 | 8.0E-12 |
| sp|P11711|CP2A1_RAT | Cytochrome P450 2A1 OS=Rattus norvegicus GN=Cyp2a1 PE=1 SV=2 | 136 | 371 | 8.0E-12 |
| sp|O61387|CP6B7_HELAM | Cytochrome P450 6B7 OS=Helicoverpa armigera GN=CYP6B7 PE=2 SV=1 | 128 | 373 | 8.0E-12 |
| sp|Q1ZXA1|C521A_DICDI | Probable cytochrome P450 521A1 OS=Dictyostelium discoideum GN=cyp521A1 PE=3 SV=1 | 7 | 369 | 9.0E-12 |
| sp|Q9QYG5|CP2DK_MESAU | Cytochrome P450 2D20 OS=Mesocricetus auratus GN=CYP2D20 PE=2 SV=1 | 172 | 371 | 9.0E-12 |
| sp|P20852|CP2A5_MOUSE | Cytochrome P450 2A5 OS=Mus musculus GN=Cyp2a5 PE=2 SV=1 | 139 | 371 | 9.0E-12 |
| sp|Q05556|CP2AB_RABIT | Cytochrome P450 2A11 OS=Oryctolagus cuniculus GN=CYP2A11 PE=1 SV=1 | 115 | 371 | 1.0E-11 |
| sp|O42563|CP3AR_ONCMY | Cytochrome P450 3A27 OS=Oncorhynchus mykiss GN=cyp3a27 PE=2 SV=1 | 164 | 392 | 1.0E-11 |
| sp|Q09653|C13AA_CAEEL | Putative cytochrome P450 CYP13A10 OS=Caenorhabditis elegans GN=cyp-13A10 PE=3 SV=3 | 164 | 372 | 1.0E-11 |
| sp|Q9SMP5|C94B3_ARATH | Cytochrome P450 94B3 OS=Arabidopsis thaliana GN=CYP94B3 PE=2 SV=1 | 107 | 376 | 1.0E-11 |
| sp|P11707|CP3A6_RABIT | Cytochrome P450 3A6 OS=Oryctolagus cuniculus GN=CYP3A6 PE=2 SV=2 | 172 | 371 | 1.0E-11 |
| sp|P79401|CP3AT_PIG | Cytochrome P450 3A29 OS=Sus scrofa GN=CYP3A29 PE=2 SV=1 | 171 | 377 | 1.0E-11 |
| sp|Q7Z449|CP2U1_HUMAN | Cytochrome P450 2U1 OS=Homo sapiens GN=CYP2U1 PE=1 SV=1 | 166 | 371 | 2.0E-11 |
| sp|Q9QYG6|CP2DR_MESAU | Cytochrome P450 2D27 OS=Mesocricetus auratus GN=CYP2D27 PE=1 SV=1 | 147 | 371 | 2.0E-11 |
| sp|Q2XNC8|CP2D6_PANTR | Cytochrome P450 2D6 OS=Pan troglodytes GN=CYP2D6 PE=3 SV=1 | 147 | 371 | 2.0E-11 |
| sp|P15392|CP2A4_MOUSE | Cytochrome P450 2A4 OS=Mus musculus GN=Cyp2a4 PE=2 SV=3 | 139 | 379 | 2.0E-11 |
| sp|Q9STL0|C71AN_ARATH | Cytochrome P450 71A23 OS=Arabidopsis thaliana GN=CYP71A23 PE=2 SV=1 | 163 | 396 | 2.0E-11 |
| sp|Q9FMY1|C86B1_ARATH | Cytochrome P450 86B1 OS=Arabidopsis thaliana GN=CYP86B1 PE=2 SV=1 | 155 | 375 | 2.0E-11 |
| sp|Q9VE00|C12A4_DROME | Probable cytochrome P450 12a4, mitochondrial OS=Drosophila melanogaster GN=Cyp12a4 PE=2 SV=2 | 136 | 393 | 2.0E-11 |
| sp|O44220|C12B1_DROAC | Cytochrome P450 12b1, mitochondrial OS=Drosophila acanthoptera GN=Cyp12b1 PE=2 SV=1 | 172 | 399 | 2.0E-11 |
| sp|Q50LH4|C7193_ESCCA | (S)-stylopine synthase 2 OS=Eschscholzia californica GN=CYP719A3 PE=1 SV=1 | 171 | 378 | 3.0E-11 |
| sp|P20853|CP2A7_HUMAN | Cytochrome P450 2A7 OS=Homo sapiens GN=CYP2A7 PE=2 SV=2 | 120 | 369 | 3.0E-11 |
| sp|P00182|CP2C3_RABIT | Cytochrome P450 2C3 OS=Oryctolagus cuniculus GN=CYP2C3 PE=1 SV=2 | 111 | 396 | 3.0E-11 |
| sp|Q9Y8G7|C505_FUSOX | Bifunctional P-450:NADPH-P450 reductase OS=Fusarium oxysporum GN=CYP505 PE=1 SV=1 | 126 | 397 | 4.0E-11 |
| sp|Q99N16|CP4F3_MOUSE | Leukotriene-B(4) omega-hydroxylase 2 OS=Mus musculus GN=Cyp4f3 PE=1 SV=2 | 164 | 376 | 4.0E-11 |
| sp|P29981|CP4C1_BLADI | Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 | 118 | 379 | 4.0E-11 |
| sp|P56593|CP2AC_MOUSE | Cytochrome P450 2A12 OS=Mus musculus GN=Cyp2a12 PE=1 SV=2 | 169 | 371 | 4.0E-11 |
| sp|Q12588|CP52J_CANMA | Cytochrome P450 52A10 OS=Candida maltosa GN=CYP52A10 PE=2 SV=1 | 163 | 369 | 4.0E-11 |
| sp|P24456|CP2DA_MOUSE | Cytochrome P450 2D10 OS=Mus musculus GN=Cyp2d10 PE=1 SV=2 | 147 | 371 | 4.0E-11 |
| sp|Q07217|CP11A_ONCMY | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Oncorhynchus mykiss GN=cyp11a1 PE=2 SV=1 | 164 | 372 | 5.0E-11 |
| sp|P51871|CP4F6_RAT | Cytochrome P450 4F6 OS=Rattus norvegicus GN=Cyp4f6 PE=2 SV=1 | 164 | 376 | 5.0E-11 |
| sp|Q92090|CP2K1_ONCMY | Cytochrome P450 2K1 OS=Oncorhynchus mykiss GN=cyp2k1 PE=2 SV=1 | 139 | 373 | 5.0E-11 |
| sp|Q4G0S4|C27C1_HUMAN | Cytochrome P450 27C1 OS=Homo sapiens GN=CYP27C1 PE=2 SV=2 | 164 | 369 | 5.0E-11 |
| sp|Q9EP75|CP4FE_MOUSE | Leukotriene-B4 omega-hydroxylase 3 OS=Mus musculus GN=Cyp4f14 PE=1 SV=1 | 164 | 376 | 6.0E-11 |
| sp|Q92100|CP1A1_PLEPL | Cytochrome P450 1A1 OS=Pleuronectes platessa GN=cyp1a1 PE=2 SV=1 | 71 | 379 | 6.0E-11 |
| sp|Q0IIF9|CP2U1_BOVIN | Cytochrome P450 2U1 OS=Bos taurus GN=CYP2U1 PE=2 SV=1 | 143 | 371 | 6.0E-11 |
| sp|P24458|CP52E_CANMA | Cytochrome P450 52A3-B OS=Candida maltosa GN=CYP52A3-B PE=1 SV=1 | 117 | 369 | 6.0E-11 |
| sp|P15149|CP2A2_RAT | Cytochrome P450 2A2 OS=Rattus norvegicus GN=Cyp2a2 PE=1 SV=1 | 169 | 371 | 7.0E-11 |
| sp|P30607|CP52B_CANTR | Cytochrome P450 52A2 OS=Candida tropicalis GN=CYP52A2 PE=1 SV=1 | 163 | 375 | 7.0E-11 |
| sp|P51870|CP4F5_RAT | Cytochrome P450 4F5 OS=Rattus norvegicus GN=Cyp4f5 PE=2 SV=1 | 111 | 376 | 7.0E-11 |
| sp|Q9VGZ0|C12E1_DROME | Probable cytochrome P450 12e1, mitochondrial OS=Drosophila melanogaster GN=Cyp12e1 PE=2 SV=4 | 172 | 378 | 8.0E-11 |
| sp|Q8CIM7|CP2DQ_MOUSE | Cytochrome P450 2D26 OS=Mus musculus GN=Cyp2d26 PE=1 SV=1 | 147 | 371 | 8.0E-11 |
| sp|B9X287|C7346_ORYSJ | Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 | 164 | 371 | 9.0E-11 |
| sp|P12790|CP2B9_MOUSE | Cytochrome P450 2B9 OS=Mus musculus GN=Cyp2b9 PE=1 SV=2 | 142 | 370 | 9.0E-11 |
| sp|O42430|CP1A1_LIMLI | Cytochrome P450 1A1 OS=Limanda limanda GN=cyp1a1 PE=2 SV=1 | 27 | 379 | 9.0E-11 |
| sp|Q91Z85|CP17A_PERLE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Peromyscus leucopus GN=Cyp17a1 PE=3 SV=1 | 45 | 377 | 9.0E-11 |
| sp|P00176|CP2B1_RAT | Cytochrome P450 2B1 OS=Rattus norvegicus GN=Cyp2b1 PE=1 SV=1 | 142 | 370 | 1.0E-10 |
| sp|P10615|CP52A_CANTR | Cytochrome P450 52A1 OS=Candida tropicalis GN=CYP52A1 PE=1 SV=3 | 151 | 370 | 1.0E-10 |
| sp|P10610|CP2G1_RAT | Cytochrome P450 2G1 OS=Rattus norvegicus GN=Cyp2g1 PE=2 SV=1 | 147 | 370 | 1.0E-10 |
| sp|P12938|CP2D3_RAT | Cytochrome P450 2D3 OS=Rattus norvegicus GN=Cyp2d3 PE=2 SV=2 | 147 | 371 | 1.0E-10 |
| sp|B6SSW8|C14B3_MAIZE | Cytochrome P450 714B3 OS=Zea mays GN=CYP714B3 PE=2 SV=1 | 115 | 371 | 1.0E-10 |
| sp|P37121|C76A1_SOLME | Cytochrome P450 76A1 (Fragment) OS=Solanum melongena GN=CYP76A1 PE=2 SV=1 | 64 | 369 | 1.0E-10 |
| sp|Q8K4D6|CP4X1_RAT | Cytochrome P450 4X1 OS=Rattus norvegicus GN=Cyp4x1 PE=2 SV=1 | 111 | 369 | 1.0E-10 |
| sp|Q05555|CP2AA_RABIT | Cytochrome P450 2A10 OS=Oryctolagus cuniculus GN=CYP2A10 PE=1 SV=1 | 115 | 371 | 1.0E-10 |
| sp|Q27712|CP2L1_PANAR | Cytochrome P450 2L1 OS=Panulirus argus GN=CYP2L1 PE=1 SV=1 | 163 | 400 | 1.0E-10 |
| sp|Q9V5L3|C49A1_DROME | Probable cytochrome P450 49a1 OS=Drosophila melanogaster GN=Cyp49a1 PE=2 SV=3 | 169 | 369 | 1.0E-10 |
| sp|P11371|CP2C4_RABIT | Cytochrome P450 2C4 OS=Oryctolagus cuniculus GN=CYP2C4 PE=2 SV=1 | 175 | 398 | 2.0E-10 |
| sp|Q16850|CP51A_HUMAN | Lanosterol 14-alpha demethylase OS=Homo sapiens GN=CYP51A1 PE=1 SV=3 | 135 | 375 | 2.0E-10 |
| sp|Q9V4T5|CP4E1_DROME | Probable cytochrome P450 4e1 OS=Drosophila melanogaster GN=Cyp4e1 PE=2 SV=1 | 161 | 381 | 2.0E-10 |
| sp|Q42569|C90A1_ARATH | Cytochrome P450 90A1 OS=Arabidopsis thaliana GN=CYP90A1 PE=2 SV=1 | 148 | 376 | 2.0E-10 |
| sp|Q9ZUX1|C94C1_ARATH | Cytochrome P450 94C1 OS=Arabidopsis thaliana GN=CYP94C1 PE=2 SV=1 | 109 | 369 | 2.0E-10 |
| sp|Q9LUC9|C7A11_ARATH | Cytochrome P450 72A11 OS=Arabidopsis thaliana GN=CYP72A11 PE=2 SV=1 | 164 | 372 | 2.0E-10 |
| sp|P51869|CP4F4_RAT | Cytochrome P450 4F4 OS=Rattus norvegicus GN=Cyp4f4 PE=2 SV=1 | 164 | 376 | 2.0E-10 |
| sp|Q0DS59|C14B2_ORYSJ | Cytochrome P450 714B2 OS=Oryza sativa subsp. japonica GN=CYP714B2 PE=1 SV=2 | 116 | 371 | 2.0E-10 |
| sp|P37122|C76A2_SOLME | Cytochrome P450 76A2 OS=Solanum melongena GN=CYP76A2 PE=2 SV=1 | 164 | 372 | 2.0E-10 |
| sp|H1A988|C7254_GLYUR | 11-oxo-beta-amyrin 30-oxidase OS=Glycyrrhiza uralensis GN=CYP72A154 PE=1 SV=1 | 111 | 372 | 2.0E-10 |
| sp|B9G934|C14C3_ORYSJ | Cytochrome P450 714C3 OS=Oryza sativa subsp. japonica GN=CYP714C3 PE=3 SV=2 | 173 | 373 | 2.0E-10 |
| sp|O46658|CP2DP_PIG | Vitamin D(3) 25-hydroxylase OS=Sus scrofa GN=CYP2D25 PE=1 SV=3 | 146 | 371 | 2.0E-10 |
| sp|O18635|C12A2_MUSDO | Cytochrome P450 CYP12A2 OS=Musca domestica GN=CYP12A2 PE=2 SV=1 | 169 | 391 | 2.0E-10 |
| sp|Q4R8S6|CP51A_MACFA | Lanosterol 14-alpha demethylase OS=Macaca fascicularis GN=CYP51A1 PE=2 SV=2 | 109 | 375 | 2.0E-10 |
| sp|Q5RE72|CP51A_PONAB | Lanosterol 14-alpha demethylase OS=Pongo abelii GN=CYP51A1 PE=2 SV=2 | 135 | 375 | 2.0E-10 |
| sp|Q64403|CP2DG_CAVPO | Cytochrome P450 2D16 OS=Cavia porcellus GN=CYP2D16 PE=1 SV=1 | 147 | 371 | 2.0E-10 |
| sp|P13527|CP6A1_MUSDO | Cytochrome P450 6A1 OS=Musca domestica GN=CYP6A1 PE=2 SV=1 | 167 | 371 | 2.0E-10 |
| sp|O44221|CP4E5_DROMT | Cytochrome P450 4e5, mitochondrial OS=Drosophila mettleri GN=Cyp4e5 PE=2 SV=1 | 164 | 392 | 2.0E-10 |
| sp|Q92104|CP11B_LITCT | Cytochrome P450 11B, mitochondrial OS=Lithobates catesbeiana GN=CYP11B PE=2 SV=1 | 163 | 376 | 2.0E-10 |
| sp|Q9YH64|CP1A1_PLAFE | Cytochrome P450 1A1 OS=Platichthys flesus GN=cyp1a1 PE=3 SV=1 | 71 | 379 | 2.0E-10 |
| sp|Q16696|CP2AD_HUMAN | Cytochrome P450 2A13 OS=Homo sapiens GN=CYP2A13 PE=1 SV=3 | 139 | 371 | 3.0E-10 |
| sp|Q01361|CP2DE_BOVIN | Cytochrome P450 2D14 OS=Bos taurus GN=CYP2D14 PE=2 SV=2 | 146 | 371 | 3.0E-10 |
| sp|P00179|CP2C5_RABIT | Cytochrome P450 2C5 OS=Oryctolagus cuniculus GN=CYP2C5 PE=1 SV=2 | 174 | 398 | 3.0E-10 |
| sp|P30610|CP52H_CANTR | Cytochrome P450 52A8 OS=Candida tropicalis GN=CYP52A8 PE=2 SV=1 | 114 | 369 | 3.0E-10 |
| sp|O54749|CP2J5_MOUSE | Cytochrome P450 2J5 OS=Mus musculus GN=Cyp2j5 PE=1 SV=1 | 155 | 378 | 3.0E-10 |
| sp|Q12581|CP52X_CANMA | Cytochrome P450 52A5 OS=Candida maltosa GN=CYP52A5 PE=1 SV=1 | 163 | 379 | 3.0E-10 |
| sp|Q92113|CP17A_SQUAC | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Squalus acanthias GN=CYP17A1 PE=2 SV=1 | 23 | 369 | 3.0E-10 |
| sp|Q42716|C71A8_MENPI | Cytochrome P450 71A8 OS=Mentha piperita GN=CYP71A8 PE=3 SV=1 | 163 | 369 | 3.0E-10 |
| sp|P43083|CP52V_CANAP | Cytochrome P450 52E1 OS=Candida apicola GN=CYP52E1 PE=3 SV=1 | 163 | 370 | 3.0E-10 |
| sp|Q54SV9|C515B_DICDI | Probable cytochrome P450 515B1 OS=Dictyostelium discoideum GN=cyp515B1 PE=2 SV=1 | 163 | 371 | 3.0E-10 |
| sp|Q9STK7|C71AQ_ARATH | Cytochrome P450 71A26 OS=Arabidopsis thaliana GN=CYP71A26 PE=3 SV=1 | 143 | 348 | 4.0E-10 |
| sp|P58046|C71AF_ARATH | Cytochrome P450 71A15 OS=Arabidopsis thaliana GN=CYP71A15 PE=3 SV=1 | 164 | 369 | 4.0E-10 |
| sp|O23365|C97B3_ARATH | Cytochrome P450 97B3, chloroplastic OS=Arabidopsis thaliana GN=CYP97B3 PE=2 SV=2 | 155 | 369 | 4.0E-10 |
| sp|B1NF20|C719E_ARGME | Cheilanthifoline synthase OS=Argemone mexicana GN=CYP719A14 PE=1 SV=1 | 155 | 369 | 4.0E-10 |
| sp|Q9VA27|CP4C3_DROME | Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 | 138 | 379 | 5.0E-10 |
| sp|Q9CX98|CP2U1_MOUSE | Cytochrome P450 2U1 OS=Mus musculus GN=Cyp2u1 PE=2 SV=2 | 166 | 371 | 5.0E-10 |
| sp|O18596|C4D10_DROMT | Cytochrome P450 4d10 OS=Drosophila mettleri GN=Cyp4d10 PE=1 SV=1 | 164 | 377 | 5.0E-10 |
| sp|Q6R7M4|C15A1_DIPPU | Methyl farnesoate epoxidase OS=Diploptera punctata GN=CYP15A1 PE=1 SV=1 | 97 | 382 | 5.0E-10 |
| sp|Q9V774|C6A21_DROME | Probable cytochrome P450 6a21 OS=Drosophila melanogaster GN=Cyp6a21 PE=2 SV=1 | 20 | 371 | 6.0E-10 |
| sp|S4UX02|CYPH1_SALMI | Ferruginol synthase OS=Salvia miltiorrhiza GN=CYP76AH1 PE=1 SV=1 | 168 | 369 | 6.0E-10 |
| sp|Q7X7X4|C99A2_ORYSJ | Cytochrome P450 99A2 OS=Oryza sativa subsp. japonica GN=CYP99A2 PE=2 SV=2 | 159 | 369 | 7.0E-10 |
| sp|O80823|C86A8_ARATH | Cytochrome P450 86A8 OS=Arabidopsis thaliana GN=CYP86A8 PE=2 SV=1 | 169 | 366 | 7.0E-10 |
| sp|Q9GMC8|CP17A_FELCA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Felis catus GN=CYP17A1 PE=2 SV=1 | 45 | 377 | 7.0E-10 |
| sp|O48921|C97B2_SOYBN | Cytochrome P450 97B2, chloroplastic OS=Glycine max GN=CYP97B2 PE=2 SV=1 | 155 | 369 | 8.0E-10 |
| sp|Q9VS79|CP4D8_DROME | Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 | 164 | 390 | 8.0E-10 |
| sp|Q9T0K2|C71AK_ARATH | Cytochrome P450 71A20 OS=Arabidopsis thaliana GN=CYP71A20 PE=2 SV=2 | 110 | 350 | 8.0E-10 |
| sp|Q07973|CP24A_HUMAN | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP24A1 PE=1 SV=2 | 173 | 376 | 8.0E-10 |
| sp|Q8TAV3|CP2W1_HUMAN | Cytochrome P450 2W1 OS=Homo sapiens GN=CYP2W1 PE=1 SV=2 | 70 | 373 | 8.0E-10 |
| sp|O54750|CP2J6_MOUSE | Cytochrome P450 2J6 OS=Mus musculus GN=Cyp2j6 PE=2 SV=2 | 169 | 378 | 9.0E-10 |
| sp|P9WPM5|CP137_MYCTU | Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp137 PE=1 SV=1 | 164 | 376 | 9.0E-10 |
| sp|P9WPM4|CP137_MYCTO | Putative cytochrome P450 137 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp137 PE=3 SV=1 | 164 | 376 | 9.0E-10 |
| sp|Q9V773|C6A20_DROME | Probable cytochrome P450 6a20 OS=Drosophila melanogaster GN=Cyp6a20 PE=2 SV=2 | 128 | 372 | 9.0E-10 |
| sp|P10612|CP11A_PIG | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Sus scrofa GN=CYP11A1 PE=1 SV=1 | 161 | 369 | 9.0E-10 |
| sp|P05185|CP17A_BOVIN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bos taurus GN=CYP17A1 PE=2 SV=1 | 135 | 388 | 9.0E-10 |
| sp|Q59205|CPXU_BRADU | Cytochrome P450 BJ-4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cyp117 PE=3 SV=2 | 139 | 358 | 1.0E-09 |
| sp|Q9DBX6|CP2S1_MOUSE | Cytochrome P450 2S1 OS=Mus musculus GN=Cyp2s1 PE=1 SV=1 | 147 | 391 | 1.0E-09 |
| sp|Q2XV99|CP11A_MACFA | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Macaca fascicularis GN=CYP11A1 PE=2 SV=1 | 164 | 369 | 1.0E-09 |
| sp|Q9XHC6|C93E1_SOYBN | Beta-amyrin 24-hydroxylase OS=Glycine max GN=CYP93E1 PE=1 SV=1 | 169 | 369 | 1.0E-09 |
| sp|O81117|C94A1_VICSA | Cytochrome P450 94A1 OS=Vicia sativa GN=CYP94A1 PE=2 SV=2 | 164 | 373 | 1.0E-09 |
| sp|Q9VMS8|C4AC2_DROME | Probable cytochrome P450 4ac2 OS=Drosophila melanogaster GN=Cyp4ac2 PE=2 SV=4 | 140 | 374 | 1.0E-09 |
| sp|Q64429|CP1B1_MOUSE | Cytochrome P450 1B1 OS=Mus musculus GN=Cyp1b1 PE=1 SV=3 | 96 | 400 | 1.0E-09 |
| sp|Q9DBG1|CP27A_MOUSE | Sterol 26-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp27a1 PE=1 SV=1 | 172 | 369 | 1.0E-09 |
| sp|P24460|CP2BB_CANLF | Cytochrome P450 2B11 OS=Canis lupus familiaris GN=CYP2B11 PE=2 SV=1 | 147 | 370 | 1.0E-09 |
| sp|O00061|CP67_UROFA | Cytochrome P450 67 (Fragment) OS=Uromyces fabae GN=CYP67 PE=2 SV=1 | 172 | 374 | 1.0E-09 |
| sp|O65782|C83B1_ARATH | Cytochrome P450 83B1 OS=Arabidopsis thaliana GN=CYP83B1 PE=1 SV=1 | 159 | 369 | 1.0E-09 |
| sp|Q9SWR5|C93C1_SOYBN | 2-hydroxyisoflavanone synthase OS=Glycine max GN=IFS2 PE=2 SV=1 | 97 | 387 | 1.0E-09 |
| sp|P51581|CP2E1_MESAU | Cytochrome P450 2E1 OS=Mesocricetus auratus GN=CYP2E1 PE=2 SV=1 | 111 | 379 | 2.0E-09 |
| sp|Q27520|C13A1_CAEEL | Putative cytochrome P450 CYP13A1 OS=Caenorhabditis elegans GN=cyp-13A1 PE=3 SV=1 | 166 | 372 | 2.0E-09 |
| sp|Q96SQ9|CP2S1_HUMAN | Cytochrome P450 2S1 OS=Homo sapiens GN=CYP2S1 PE=1 SV=2 | 147 | 399 | 2.0E-09 |
| sp|Q6VVX0|CP2R1_HUMAN | Vitamin D 25-hydroxylase OS=Homo sapiens GN=CYP2R1 PE=1 SV=1 | 111 | 369 | 2.0E-09 |
| sp|P00178|CP2B4_RABIT | Cytochrome P450 2B4 OS=Oryctolagus cuniculus GN=CYP2B4 PE=1 SV=1 | 142 | 370 | 2.0E-09 |
| sp|Q64441|CP24A_MOUSE | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Mus musculus GN=Cyp24a1 PE=2 SV=1 | 173 | 375 | 2.0E-09 |
| sp|Q9MZY0|CP2E1_CANLF | Cytochrome P450 2E1 OS=Canis lupus familiaris GN=CYP2E1 PE=2 SV=1 | 96 | 396 | 2.0E-09 |
| sp|Q8L7D5|THAH_ARATH | Cytochrome P450 708A2 OS=Arabidopsis thaliana GN=CYP708A2 PE=2 SV=3 | 168 | 377 | 2.0E-09 |
| sp|Q6Z6D6|C7342_ORYSJ | Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 | 41 | 369 | 2.0E-09 |
| sp|P47195|C80A1_BERST | Berbamunine synthase OS=Berberis stolonifera GN=CYP80A1 PE=1 SV=1 | 156 | 389 | 2.0E-09 |
| sp|Q64678|CP1B1_RAT | Cytochrome P450 1B1 OS=Rattus norvegicus GN=Cyp1b1 PE=1 SV=1 | 96 | 365 | 2.0E-09 |
| sp|P05108|CP11A_HUMAN | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Homo sapiens GN=CYP11A1 PE=1 SV=2 | 164 | 369 | 2.0E-09 |
| sp|A0A087X1C5|CP2D7_HUMAN | Putative cytochrome P450 2D7 OS=Homo sapiens GN=CYP2D7 PE=5 SV=1 | 142 | 371 | 2.0E-09 |
| sp|Q6A152|CP4X1_MOUSE | Cytochrome P450 4X1 OS=Mus musculus GN=Cyp4x1 PE=1 SV=1 | 111 | 373 | 2.0E-09 |
| sp|P16496|CP52C_CANMA | Cytochrome P450 52A3-A OS=Candida maltosa GN=CYP52A3-A PE=1 SV=3 | 163 | 354 | 2.0E-09 |
| sp|B9GBJ9|C14C1_ORYSJ | Cytochrome P450 714C1 OS=Oryza sativa subsp. japonica GN=CYP714C1 PE=2 SV=1 | 173 | 373 | 2.0E-09 |
| sp|P52786|CP2J1_RABIT | Cytochrome P450 2J1 OS=Oryctolagus cuniculus GN=CYP2J1 PE=1 SV=2 | 71 | 378 | 3.0E-09 |
| sp|Q05421|CP2E1_MOUSE | Cytochrome P450 2E1 OS=Mus musculus GN=Cyp2e1 PE=1 SV=1 | 147 | 396 | 3.0E-09 |
| sp|Q9VYQ7|CP311_DROME | Probable cytochrome P450 311a1 OS=Drosophila melanogaster GN=Cyp311a1 PE=2 SV=1 | 164 | 372 | 3.0E-09 |
| sp|O46420|CP51A_PIG | Lanosterol 14-alpha demethylase OS=Sus scrofa GN=CYP51A1 PE=2 SV=1 | 109 | 375 | 3.0E-09 |
| sp|Q27664|CP6B2_HELAM | Cytochrome P450 6B2 OS=Helicoverpa armigera GN=CYP6B2 PE=2 SV=1 | 171 | 373 | 3.0E-09 |
| sp|Q8LIF2|C7345_ORYSJ | Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 | 156 | 396 | 3.0E-09 |
| sp|P04167|CP2B2_RAT | Cytochrome P450 2B2 OS=Rattus norvegicus GN=Cyp2b2 PE=1 SV=2 | 142 | 370 | 3.0E-09 |
| sp|Q12573|CP52W_CANAP | Cytochrome P450 52E2 OS=Candida apicola GN=CYP52E2 PE=3 SV=1 | 163 | 370 | 3.0E-09 |
| sp|Q86W10|CP4Z1_HUMAN | Cytochrome P450 4Z1 OS=Homo sapiens GN=CYP4Z1 PE=2 SV=1 | 148 | 373 | 3.0E-09 |
| sp|Q9N0U7|CP17A_CAPHI | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Capra hircus GN=CYP17A1 PE=2 SV=1 | 135 | 388 | 4.0E-09 |
| sp|Q9V4U9|C6A13_DROME | Probable cytochrome P450 6a13 OS=Drosophila melanogaster GN=Cyp6a13 PE=2 SV=1 | 167 | 371 | 4.0E-09 |
| sp|Q9Y758|CP52M_DEBHN | Cytochrome P450 52A13 OS=Debaryomyces hansenii GN=CYP52A13 PE=2 SV=1 | 163 | 369 | 4.0E-09 |
| sp|P33270|CP6A2_DROME | Cytochrome P450 6a2 OS=Drosophila melanogaster GN=Cyp6a2 PE=2 SV=2 | 167 | 369 | 4.0E-09 |
| sp|Q4PJW3|CP51A_BOVIN | Lanosterol 14-alpha demethylase OS=Bos taurus GN=CYP51A1 PE=2 SV=1 | 106 | 375 | 4.0E-09 |
| sp|O48956|C98A1_SORBI | Cytochrome P450 98A1 OS=Sorghum bicolor GN=CYP98A1 PE=2 SV=1 | 11 | 369 | 4.0E-09 |
| sp|Q4V8D1|CP2U1_RAT | Cytochrome P450 2U1 OS=Rattus norvegicus GN=Cyp2u1 PE=1 SV=1 | 166 | 371 | 4.0E-09 |
| sp|P36423|THAS_MOUSE | Thromboxane-A synthase OS=Mus musculus GN=Tbxas1 PE=1 SV=2 | 162 | 372 | 4.0E-09 |
| sp|Q92088|CP2M1_ONCMY | Cytochrome P450 2M1 OS=Oncorhynchus mykiss GN=cyp2m1 PE=1 SV=1 | 175 | 399 | 4.0E-09 |
| sp|P98187|CP4F8_HUMAN | Cytochrome P450 4F8 OS=Homo sapiens GN=CYP4F8 PE=1 SV=1 | 48 | 373 | 5.0E-09 |
| sp|P24465|C71A1_PERAE | Cytochrome P450 71A1 OS=Persea americana GN=CYP71A1 PE=1 SV=2 | 168 | 379 | 5.0E-09 |
| sp|O23066|C86A2_ARATH | Cytochrome P450 86A2 OS=Arabidopsis thaliana GN=CYP86A2 PE=1 SV=1 | 164 | 366 | 5.0E-09 |
| sp|Q9VLZ7|C4D21_DROME | Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 | 93 | 374 | 5.0E-09 |
| sp|Q12589|CP52K_CANMA | Cytochrome P450 52A11 OS=Candida maltosa GN=CYP52A11 PE=2 SV=1 | 163 | 369 | 5.0E-09 |
| sp|Q9VMS7|C4AC3_DROME | Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 | 139 | 379 | 5.0E-09 |
| sp|P56591|CP1A1_SHEEP | Cytochrome P450 1A1 OS=Ovis aries GN=CYP1A1 PE=2 SV=1 | 164 | 371 | 5.0E-09 |
| sp|Q02318|CP27A_HUMAN | Sterol 26-hydroxylase, mitochondrial OS=Homo sapiens GN=CYP27A1 PE=1 SV=1 | 172 | 369 | 5.0E-09 |
| sp|P11714|CP2D9_MOUSE | Cytochrome P450 2D9 OS=Mus musculus GN=Cyp2d9 PE=1 SV=2 | 174 | 371 | 6.0E-09 |
| sp|Q9T0K0|C71AJ_ARATH | Cytochrome P450 71A19 OS=Arabidopsis thaliana GN=CYP71A19 PE=2 SV=1 | 172 | 350 | 6.0E-09 |
| sp|Q9LJY7|C75AK_ARATH | Cytochrome P450 705A20 OS=Arabidopsis thaliana GN=CYP705A20 PE=2 SV=1 | 164 | 369 | 6.0E-09 |
| sp|Q98T91|C340_ORYLA | Cytochrome P450 3A40 OS=Oryzias latipes GN=cyp3a40 PE=2 SV=1 | 164 | 383 | 6.0E-09 |
| sp|Q078T0|PHACB_EMEND | 3-hydroxyphenylacetate 6-hydroxylase OS=Emericella nidulans GN=phacB PE=1 SV=1 | 169 | 398 | 6.0E-09 |
| sp|P17178|CP27A_RAT | Sterol 26-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp27a1 PE=1 SV=1 | 172 | 369 | 6.0E-09 |
| sp|Q50LH3|C7192_ESCCA | (S)-stylopine synthase 1 OS=Eschscholzia californica GN=CYP719A2 PE=1 SV=1 | 166 | 378 | 6.0E-09 |
| sp|Q9VMS9|C4AC1_DROME | Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 | 139 | 379 | 6.0E-09 |
| sp|Q759W0|CP51_ASHGO | Lanosterol 14-alpha demethylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG11 PE=3 SV=1 | 164 | 372 | 7.0E-09 |
| sp|Q43078|C97B1_PEA | Cytochrome P450 97B1, chloroplastic OS=Pisum sativum GN=CYP97B1 PE=2 SV=1 | 155 | 365 | 7.0E-09 |
| sp|Q27516|C13A8_CAEEL | Putative cytochrome P450 CYP13A8 OS=Caenorhabditis elegans GN=cyp-13A8 PE=3 SV=2 | 164 | 372 | 7.0E-09 |
| sp|O48927|C78A3_SOYBN | Cytochrome P450 78A3 OS=Glycine max GN=CYP78A3 PE=2 SV=1 | 172 | 387 | 7.0E-09 |
| sp|P05093|CP17A_HUMAN | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Homo sapiens GN=CYP17A1 PE=1 SV=1 | 126 | 396 | 8.0E-09 |
| sp|Q9Y757|CP52L_DEBHN | Cytochrome P450 52A12 OS=Debaryomyces hansenii GN=CYP52A12 PE=2 SV=2 | 117 | 354 | 8.0E-09 |
| sp|Q6GUQ4|CP2E1_MACMU | Cytochrome P450 2E1 OS=Macaca mulatta GN=CYP2E1 PE=2 SV=1 | 172 | 394 | 8.0E-09 |
| sp|B3RFJ6|86A22_PETHY | Cytochrome P450 86A22 OS=Petunia hybrida GN=CYP86A22 PE=1 SV=1 | 169 | 366 | 9.0E-09 |
| sp|C0SJS2|C71AJ_PASSA | Psoralen synthase (Fragment) OS=Pastinaca sativa GN=CYP71AJ3 PE=1 SV=1 | 75 | 386 | 9.0E-09 |
| sp|Q9GMC7|CP17A_BISBI | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Bison bison GN=CYP17A1 PE=2 SV=1 | 135 | 388 | 9.0E-09 |
| sp|P48422|C86A1_ARATH | Cytochrome P450 86A1 OS=Arabidopsis thaliana GN=CYP86A1 PE=1 SV=2 | 169 | 374 | 1.0E-08 |
| sp|P29980|CPXN_NOSS1 | Probable cytochrome P450 110 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cyp110 PE=3 SV=3 | 148 | 369 | 1.0E-08 |
| sp|Q93ZB2|KO1_ARATH | Ent-kaurene oxidase, chloroplastic OS=Arabidopsis thaliana GN=KO PE=1 SV=2 | 177 | 384 | 1.0E-08 |
| sp|Q29497|CP17A_SHEEP | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Ovis aries GN=CYP17A1 PE=2 SV=2 | 174 | 388 | 1.0E-08 |
| sp|Q9LMM1|C86A4_ARATH | Cytochrome P450 86A4 OS=Arabidopsis thaliana GN=CYP86A4 PE=1 SV=1 | 140 | 366 | 1.0E-08 |
| sp|Q12586|CP52I_CANMA | Cytochrome P450 52A9 OS=Candida maltosa GN=CYP52A9 PE=1 SV=1 | 163 | 369 | 1.0E-08 |
| sp|P16141|CP52D_CANMA | Cytochrome P450 52A4 OS=Candida maltosa GN=CYP52A4 PE=1 SV=4 | 117 | 369 | 1.0E-08 |
| sp|E9Q816|CP2W1_MOUSE | Cytochrome P450 2W1 OS=Mus musculus GN=Cyp2w1 PE=2 SV=1 | 68 | 373 | 1.0E-08 |
| sp|Q5Z5R4|C7016_ORYSJ | Ent-kaurene oxidase 2 OS=Oryza sativa subsp. japonica GN=CYP701A6 PE=1 SV=1 | 172 | 354 | 1.0E-08 |
| sp|Q95031|CP6B6_HELAM | Cytochrome P450 6B6 OS=Helicoverpa armigera GN=CYP6B6 PE=2 SV=1 | 141 | 373 | 1.0E-08 |
| sp|H2KYS3|DAF9_CAEEL | Cytochrome P450 daf-9 OS=Caenorhabditis elegans GN=daf-9 PE=1 SV=1 | 174 | 374 | 1.0E-08 |
| sp|P56594|CP2CL_CANLF | Cytochrome P450 2C21 (Fragment) OS=Canis lupus familiaris GN=CYP2C21 PE=2 SV=2 | 147 | 396 | 1.0E-08 |
| sp|O49340|C71AC_ARATH | Cytochrome P450 71A12 OS=Arabidopsis thaliana GN=CYP71A12 PE=2 SV=1 | 164 | 369 | 1.0E-08 |
| sp|O48958|C71E1_SORBI | 4-hydroxyphenylacetaldehyde oxime monooxygenase OS=Sorghum bicolor GN=CYP71E1 PE=2 SV=1 | 159 | 369 | 1.0E-08 |
| sp|P33272|CP2BC_RAT | Cytochrome P450 2B12 OS=Rattus norvegicus GN=Cyp2b12 PE=2 SV=1 | 142 | 370 | 2.0E-08 |
| sp|Q8HYN1|CP17A_PANTR | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Pan troglodytes GN=CYP17A1 PE=2 SV=1 | 126 | 396 | 2.0E-08 |
| sp|Q9ZNR0|C78A6_ARATH | Cytochrome P450 78A6 OS=Arabidopsis thaliana GN=CYP78A6 PE=2 SV=1 | 175 | 387 | 2.0E-08 |
| sp|P05182|CP2E1_RAT | Cytochrome P450 2E1 OS=Rattus norvegicus GN=Cyp2e1 PE=1 SV=4 | 147 | 396 | 2.0E-08 |
| sp|Q9V419|C28A5_DROME | Probable cytochrome P450 28a5 OS=Drosophila melanogaster GN=Cyp28a5 PE=2 SV=1 | 144 | 369 | 2.0E-08 |
| sp|P9WPN3|CP132_MYCTU | Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cyp132 PE=1 SV=1 | 164 | 372 | 2.0E-08 |
| sp|P9WPN2|CP132_MYCTO | Putative cytochrome P450 132 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cyp132 PE=3 SV=1 | 164 | 372 | 2.0E-08 |
| sp|P59954|CP132_MYCBO | Putative cytochrome P450 132 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cyp132 PE=3 SV=1 | 164 | 372 | 2.0E-08 |
| sp|P79153|CP11A_CAPHI | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Capra hircus GN=CYP11A1 PE=2 SV=1 | 139 | 372 | 2.0E-08 |
| sp|P14779|CPXB_BACME | Bifunctional cytochrome P450/NADPH--P450 reductase OS=Bacillus megaterium GN=cyp102A1 PE=1 SV=2 | 154 | 399 | 2.0E-08 |
| sp|Q9GLD2|CP17A_PAPHU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio hamadryas ursinus GN=CYP17A1 PE=1 SV=1 | 135 | 396 | 2.0E-08 |
| sp|P30437|CP17A_ONCMY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oncorhynchus mykiss GN=cyp17a1 PE=2 SV=1 | 139 | 358 | 2.0E-08 |
| sp|P12791|CP2BA_MOUSE | Cytochrome P450 2B10 OS=Mus musculus GN=Cyp2b10 PE=1 SV=1 | 116 | 370 | 2.0E-08 |
| sp|O81974|C71D8_SOYBN | Cytochrome P450 71D8 OS=Glycine max GN=CYP71D8 PE=2 SV=1 | 90 | 372 | 2.0E-08 |
| sp|P12789|CP2B5_RABIT | Cytochrome P450 2B5 OS=Oryctolagus cuniculus GN=CYP2B5 PE=2 SV=1 | 142 | 370 | 2.0E-08 |
| sp|B9DFU2|MAX1_ARATH | Cytochrome P450 711A1 OS=Arabidopsis thaliana GN=CYP711A1 PE=2 SV=1 | 159 | 371 | 2.0E-08 |
| sp|Q556M5|C5081_DICDI | Probable cytochrome P450 508A1 OS=Dictyostelium discoideum GN=cyp508A1-1 PE=3 SV=1 | 171 | 386 | 3.0E-08 |
| sp|P08683|CP2CB_RAT | Cytochrome P450 2C11 OS=Rattus norvegicus GN=Cyp2c11 PE=1 SV=1 | 146 | 369 | 3.0E-08 |
| sp|Q92039|CP1A1_CHACA | Cytochrome P450 1A1 OS=Chaetodon capistratus GN=cyp1a1 PE=2 SV=1 | 45 | 371 | 3.0E-08 |
| sp|P79202|CP11A_SHEEP | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Ovis aries GN=CYP11A1 PE=1 SV=1 | 139 | 369 | 3.0E-08 |
| sp|Q27593|CP6A8_DROME | Cytochrome P450 6a8 OS=Drosophila melanogaster GN=Cyp6a8 PE=2 SV=2 | 90 | 371 | 3.0E-08 |
| sp|Q9STK8|C71AP_ARATH | Cytochrome P450 71A25 OS=Arabidopsis thaliana GN=CYP71A25 PE=2 SV=1 | 20 | 348 | 3.0E-08 |
| sp|Q8HYM9|CP17A_MACMU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca mulatta GN=CYP17A1 PE=2 SV=1 | 131 | 396 | 3.0E-08 |
| sp|Q2XVA1|CP17A_MACFA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Macaca fascicularis GN=CYP17A1 PE=2 SV=1 | 131 | 396 | 3.0E-08 |
| sp|Q8HYN0|CP17A_PAPCY | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Papio cynocephalus GN=CYP17A1 PE=2 SV=1 | 135 | 396 | 3.0E-08 |
| sp|H2DH17|C7A22_PANGI | Cytochrome P450 CYP749A22 OS=Panax ginseng PE=2 SV=1 | 164 | 373 | 3.0E-08 |
| sp|Q9ZW95|C7352_ARATH | Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 | 164 | 371 | 3.0E-08 |
| sp|Q9QZ82|CP11A_MOUSE | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Mus musculus GN=Cyp11a1 PE=1 SV=1 | 164 | 369 | 4.0E-08 |
| sp|Q9VB31|C6A18_DROME | Probable cytochrome P450 6a18 OS=Drosophila melanogaster GN=Cyp6a18 PE=2 SV=1 | 90 | 373 | 4.0E-08 |
| sp|O04164|C71A6_NEPRA | Cytochrome P450 71A6 (Fragment) OS=Nepeta racemosa GN=CYP71A6 PE=2 SV=1 | 163 | 271 | 4.0E-08 |
| sp|P14263|CP51_CANTR | Lanosterol 14-alpha demethylase OS=Candida tropicalis GN=ERG11 PE=3 SV=2 | 164 | 391 | 4.0E-08 |
| sp|Q09128|CP24A_RAT | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial OS=Rattus norvegicus GN=Cyp24a1 PE=1 SV=1 | 173 | 376 | 4.0E-08 |
| sp|Q12732|AVNA_ASPPA | Averantin hydroxylase OS=Aspergillus parasiticus GN=avnA PE=1 SV=2 | 135 | 369 | 5.0E-08 |
| sp|P15128|CP4B1_RABIT | Cytochrome P450 4B1 OS=Oryctolagus cuniculus GN=CYP4B1 PE=1 SV=1 | 107 | 374 | 5.0E-08 |
| sp|Q9LJK2|ABAH4_ARATH | Abscisic acid 8'-hydroxylase 4 OS=Arabidopsis thaliana GN=CYP707A4 PE=2 SV=2 | 164 | 369 | 5.0E-08 |
| sp|Q949P1|ABAH1_ARATH | Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 | 109 | 380 | 5.0E-08 |
| sp|Q5Z5S6|C7019_ORYSJ | Ent-kaurene oxidase-like 5 OS=Oryza sativa subsp. japonica GN=CYP701A9 PE=2 SV=1 | 177 | 354 | 5.0E-08 |
| sp|Q0J185|ABAH3_ORYSJ | Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. japonica GN=CYP707A7 PE=2 SV=1 | 164 | 374 | 6.0E-08 |
| sp|A2Z212|ABAH3_ORYSI | Abscisic acid 8'-hydroxylase 3 OS=Oryza sativa subsp. indica GN=CYP707A7 PE=3 SV=1 | 164 | 374 | 6.0E-08 |
| sp|Q64654|CP51A_RAT | Lanosterol 14-alpha demethylase OS=Rattus norvegicus GN=Cyp51a1 PE=2 SV=1 | 106 | 375 | 6.0E-08 |
| sp|Q9SAB6|C71AI_ARATH | Cytochrome P450 71A18 OS=Arabidopsis thaliana GN=CYP71A18 PE=2 SV=2 | 164 | 373 | 6.0E-08 |
| sp|P13107|CP2B3_RAT | Cytochrome P450 2B3 OS=Rattus norvegicus GN=Cyp2b3 PE=2 SV=1 | 148 | 396 | 6.0E-08 |
| sp|P24457|CP2DB_MOUSE | Cytochrome P450 2D11 OS=Mus musculus GN=Cyp2d11 PE=2 SV=2 | 147 | 370 | 6.0E-08 |
| sp|Q6TBX7|LUT1_ARATH | Carotene epsilon-monooxygenase, chloroplastic OS=Arabidopsis thaliana GN=CYP97C1 PE=1 SV=1 | 161 | 366 | 7.0E-08 |
| sp|Q6NKZ8|C14A2_ARATH | Cytochrome P450 714A2 OS=Arabidopsis thaliana GN=CYP714A2 PE=2 SV=1 | 160 | 371 | 7.0E-08 |
| sp|Q2QYH7|C14C2_ORYSJ | Cytochrome P450 714C2 OS=Oryza sativa subsp. japonica GN=CYP714C2 PE=2 SV=1 | 134 | 371 | 8.0E-08 |
| sp|Q43246|C88A1_MAIZE | Cytochrome P450 88A1 OS=Zea mays GN=CYP88A1 PE=2 SV=1 | 132 | 369 | 1.0E-07 |
| sp|P15150|C11B1_BOVIN | Cytochrome P450 11B1, mitochondrial OS=Bos taurus GN=CYP11B1 PE=1 SV=2 | 128 | 376 | 1.0E-07 |
| sp|L7X3S1|MSH_PAPSO | Methyltetrahydroprotoberberine 14-monooxygenase OS=Papaver somniferum GN=CYP82N4 PE=1 SV=1 | 154 | 375 | 1.0E-07 |
| sp|P51663|C11B1_SHEEP | Cytochrome P450 11B1, mitochondrial OS=Ovis aries GN=CYP11B1 PE=2 SV=2 | 128 | 369 | 1.0E-07 |
| sp|P03940|CP21A_MOUSE | Steroid 21-hydroxylase OS=Mus musculus GN=Cyp21 PE=2 SV=3 | 164 | 373 | 1.0E-07 |
| sp|P05181|CP2E1_HUMAN | Cytochrome P450 2E1 OS=Homo sapiens GN=CYP2E1 PE=1 SV=1 | 172 | 379 | 1.0E-07 |
| sp|P33266|CP2E1_MACFA | Cytochrome P450 2E1 (Fragment) OS=Macaca fascicularis GN=CYP2E1 PE=2 SV=1 | 172 | 394 | 1.0E-07 |
| sp|Q92148|CP1A1_MICTO | Cytochrome P450 1A1 OS=Microgadus tomcod GN=cyp1a1 PE=2 SV=1 | 163 | 379 | 1.0E-07 |
| sp|Q8K0C4|CP51A_MOUSE | Lanosterol 14-alpha demethylase OS=Mus musculus GN=Cyp51a1 PE=1 SV=1 | 106 | 375 | 1.0E-07 |
| sp|Q50EK4|C75A1_PINTA | Cytochrome P450 750A1 OS=Pinus taeda GN=CYP750A1 PE=2 SV=1 | 175 | 369 | 1.0E-07 |
| sp|Q6F4F5|C724B_ORYSJ | Cytochrome P450 724B1 OS=Oryza sativa subsp. japonica GN=CYP724B1 PE=1 SV=1 | 168 | 357 | 1.0E-07 |
| sp|Q5Z5R7|C701S_ORYSJ | Ent-kaurene oxidase-like 3 OS=Oryza sativa subsp. japonica GN=CYP701A19 PE=2 SV=1 | 172 | 354 | 1.0E-07 |
| sp|Q9VYY4|C4G15_DROME | Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 | 164 | 369 | 1.0E-07 |
| sp|P70687|CP17A_MESAU | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Mesocricetus auratus GN=CYP17A1 PE=2 SV=1 | 45 | 376 | 1.0E-07 |
| sp|Q42798|C93A1_SOYBN | 3,9-dihydroxypterocarpan 6A-monooxygenase OS=Glycine max GN=CYP93A1 PE=1 SV=1 | 164 | 369 | 1.0E-07 |
| sp|Q93Z79|C14A1_ARATH | Cytochrome P450 714A1 OS=Arabidopsis thaliana GN=CYP714A1 PE=2 SV=1 | 160 | 371 | 1.0E-07 |
| sp|O81077|ABAH2_ARATH | Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP707A2 PE=2 SV=1 | 164 | 270 | 2.0E-07 |
| sp|P48420|C78A1_MAIZE | Cytochrome P450 78A1 OS=Zea mays GN=CYP78A1 PE=2 SV=1 | 136 | 369 | 2.0E-07 |
| sp|Q9CAD6|C86A7_ARATH | Cytochrome P450 86A7 OS=Arabidopsis thaliana GN=CYP86A7 PE=2 SV=1 | 109 | 366 | 2.0E-07 |
| sp|O08394|CYPD_BACSU | Bifunctional cytochrome P450/NADPH--P450 reductase 1 OS=Bacillus subtilis (strain 168) GN=cypD PE=1 SV=1 | 164 | 399 | 2.0E-07 |
| sp|P93531|C71D7_SOLCH | Cytochrome P450 71D7 OS=Solanum chacoense GN=CYP71D7 PE=3 SV=1 | 164 | 369 | 2.0E-07 |
| sp|P70085|CP17A_ORYLA | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Oryzias latipes GN=cyp17a1 PE=2 SV=1 | 45 | 382 | 2.0E-07 |
| sp|Q5KQH7|C14D1_ORYSJ | Cytochrome P450 714D1 OS=Oryza sativa subsp. japonica GN=CYP714D1 PE=1 SV=1 | 164 | 371 | 2.0E-07 |
| sp|O65438|C71AR_ARATH | Cytochrome P450 71A27 OS=Arabidopsis thaliana GN=CYP71A27 PE=3 SV=3 | 172 | 376 | 2.0E-07 |
| sp|Q95328|CP17A_HORSE | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Equus caballus GN=CYP17A1 PE=2 SV=1 | 135 | 377 | 3.0E-07 |
| sp|Q9V558|CP4P1_DROME | Cytochrome P450 4p1 OS=Drosophila melanogaster GN=Cyp4p1 PE=2 SV=1 | 163 | 373 | 3.0E-07 |
| sp|P17177|CP27A_RABIT | Sterol 26-hydroxylase, mitochondrial OS=Oryctolagus cuniculus GN=CYP27A1 PE=2 SV=1 | 172 | 369 | 3.0E-07 |
| sp|Q4WAW5|FTMC_ASPFU | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmP450-1 PE=3 SV=2 | 126 | 369 | 3.0E-07 |
| sp|B9WZX1|FTMC_ASPFM | Tryprostatin B 6-hydroxylase OS=Neosartorya fumigata GN=ftmP450-1 PE=1 SV=1 | 126 | 369 | 3.0E-07 |
| sp|P30609|CP52G_CANTR | Cytochrome P450 52A7 OS=Candida tropicalis GN=CYP52A7 PE=2 SV=1 | 151 | 369 | 3.0E-07 |
| sp|Q92095|CP1A1_OPSTA | Cytochrome P450 1A1 OS=Opsanus tau GN=cyp1a1 PE=2 SV=1 | 71 | 271 | 4.0E-07 |
| sp|P55540|CPXU_RHISN | Cytochrome P450 BJ-4 homolog OS=Rhizobium sp. (strain NGR234) GN=cyp117A2 PE=3 SV=1 | 109 | 358 | 4.0E-07 |
| sp|O64635|C76C4_ARATH | Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 | 126 | 369 | 4.0E-07 |
| sp|Q8AXY5|C356_FUNHE | Cytochrome P450 3A56 OS=Fundulus heteroclitus GN=cyp3a56 PE=2 SV=1 | 164 | 383 | 5.0E-07 |
| sp|Q9PVE8|C330_FUNHE | Cytochrome P450 3A30 OS=Fundulus heteroclitus GN=cyp3a30 PE=2 SV=2 | 164 | 383 | 5.0E-07 |
| sp|P93530|C71D6_SOLCH | Cytochrome P450 71D6 OS=Solanum chacoense GN=CYP71D6 PE=2 SV=1 | 164 | 369 | 5.0E-07 |
| sp|Q9K498|EIZFM_STRCO | Epi-isozizaene 5-monooxygenase/(E)-beta-farnesene synthase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5223 PE=1 SV=1 | 129 | 387 | 5.0E-07 |
| sp|Q9NGX9|CP302_DROME | Cytochrome P450 302a1, mitochondrial OS=Drosophila melanogaster GN=dib PE=2 SV=2 | 165 | 354 | 5.0E-07 |
| sp|D1MI46|C76BA_SWEMU | Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 | 91 | 369 | 5.0E-07 |
| sp|Q9FF18|C7351_ARATH | Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 | 164 | 371 | 6.0E-07 |
| sp|P14137|CP11A_RAT | Cholesterol side-chain cleavage enzyme, mitochondrial OS=Rattus norvegicus GN=Cyp11a1 PE=2 SV=1 | 164 | 369 | 7.0E-07 |
| sp|Q9FH76|ABAH3_ARATH | Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 | 164 | 362 | 7.0E-07 |
| sp|Q69XM6|C7344_ORYSJ | Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 | 166 | 369 | 7.0E-07 |
| sp|Q6Z5I7|C76M6_ORYSJ | Oryzalexin E synthase OS=Oryza sativa subsp. japonica GN=CYP76M6 PE=1 SV=1 | 148 | 350 | 9.0E-07 |
| sp|Q9C5Y2|KAO2_ARATH | Ent-kaurenoic acid oxidase 2 OS=Arabidopsis thaliana GN=KAO2 PE=2 SV=2 | 154 | 358 | 9.0E-07 |
| sp|A6YIH8|C7D55_HYOMU | Premnaspirodiene oxygenase OS=Hyoscyamus muticus GN=CYP71D55 PE=1 SV=1 | 72 | 369 | 1.0E-06 |
| sp|O93297|CP2K4_ONCMY | Cytochrome P450 2K4 OS=Oncorhynchus mykiss GN=cyp2k4 PE=2 SV=1 | 139 | 373 | 1.0E-06 |
| sp|Q7XHW5|C14B1_ORYSJ | Cytochrome P450 714B1 OS=Oryza sativa subsp. japonica GN=CYP714B1 PE=1 SV=2 | 97 | 369 | 1.0E-06 |
| sp|O81973|C93A3_SOYBN | Cytochrome P450 93A3 OS=Glycine max GN=CYP93A3 PE=2 SV=1 | 164 | 369 | 1.0E-06 |
| sp|O64636|C76C1_ARATH | Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 | 164 | 369 | 2.0E-06 |
| sp|G4XV71|C93C2_GLYUR | 2-hydroxyisoflavanone synthase OS=Glycyrrhiza uralensis GN=CYP93C2 PE=2 SV=2 | 164 | 369 | 2.0E-06 |
| sp|P15393|C11B1_RAT | Cytochrome P450 11B1, mitochondrial OS=Rattus norvegicus GN=Cyp11b1 PE=1 SV=1 | 163 | 357 | 2.0E-06 |
| sp|Q94FM7|C71DK_TOBAC | 5-epiaristolochene 1,3-dihydroxylase OS=Nicotiana tabacum GN=CYP71D20 PE=1 SV=2 | 164 | 369 | 2.0E-06 |
| sp|Q64410|CP17A_CAVPO | Steroid 17-alpha-hydroxylase/17,20 lyase OS=Cavia porcellus GN=CYP17A1 PE=1 SV=1 | 45 | 396 | 2.0E-06 |
| sp|Q9SBQ9|F3PH_PETHY | Flavonoid 3'-monooxygenase OS=Petunia hybrida GN=CYP75B2 PE=2 SV=1 | 55 | 378 | 2.0E-06 |
| sp|Q69X58|C76M7_ORYSJ | Ent-cassadiene C11-alpha-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP76M7 PE=1 SV=1 | 91 | 271 | 2.0E-06 |
| sp|P48416|CP10_LYMST | Cytochrome P450 10 OS=Lymnaea stagnalis GN=CYP10 PE=2 SV=1 | 168 | 371 | 2.0E-06 |
| sp|Q9UVC3|CP51_CUNEL | Lanosterol 14-alpha demethylase OS=Cunninghamella elegans GN=CYP51 PE=3 SV=1 | 168 | 386 | 4.0E-06 |
| sp|Q05JG2|ABAH1_ORYSJ | Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. japonica GN=CYP707A5 PE=2 SV=1 | 164 | 270 | 5.0E-06 |
| sp|Q09J79|ABAH1_ORYSI | Abscisic acid 8'-hydroxylase 1 OS=Oryza sativa subsp. indica GN=CYP707A5 PE=2 SV=1 | 164 | 270 | 5.0E-06 |
| sp|Q29552|C11B1_PIG | Cytochrome P450 11B1, mitochondrial OS=Sus scrofa GN=CYP11B1 PE=2 SV=1 | 163 | 369 | 5.0E-06 |
| sp|Q9SXS3|C93C2_GLYEC | 2-hydroxyisoflavanone synthase OS=Glycyrrhiza echinata GN=CYP93C2 PE=1 SV=1 | 164 | 369 | 5.0E-06 |
| sp|P15539|C11B2_MOUSE | Cytochrome P450 11B2, mitochondrial OS=Mus musculus GN=Cyp11b2 PE=2 SV=3 | 163 | 376 | 6.0E-06 |
| sp|O64637|C76C2_ARATH | Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 | 174 | 369 | 7.0E-06 |
| sp|Q43068|C82A1_PEA | Cytochrome P450 82A1 (Fragment) OS=Pisum sativum GN=CYP82A1 PE=2 SV=2 | 164 | 385 | 7.0E-06 |
| sp|O64989|C90B1_ARATH | Cytochrome P450 90B1 OS=Arabidopsis thaliana GN=CYP90B1 PE=1 SV=2 | 155 | 385 | 8.0E-06 |
| sp|P24470|CP2CN_RAT | Cytochrome P450 2C23 OS=Rattus norvegicus GN=Cyp2c23 PE=2 SV=2 | 183 | 396 | 1.0E-05 |
| sp|P58045|C71AE_ARATH | Cytochrome P450 71A14 OS=Arabidopsis thaliana GN=CYP71A14 PE=2 SV=1 | 168 | 386 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0004497 | monooxygenase activity | Yes |
| GO:0016705 | oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen | Yes |
| GO:0005506 | iron ion binding | Yes |
| GO:0020037 | heme binding | Yes |
| GO:0016491 | oxidoreductase activity | No |
| GO:0046906 | tetrapyrrole binding | No |
| GO:0003824 | catalytic activity | No |
| GO:0046872 | metal ion binding | No |
| GO:0046914 | transition metal ion binding | No |
| GO:0097159 | organic cyclic compound binding | No |
| GO:0005488 | binding | No |
| GO:0043167 | ion binding | No |
| GO:1901363 | heterocyclic compound binding | No |
| GO:0043169 | cation binding | No |
| GO:0003674 | molecular_function | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 12 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|5414 LWTLKQSRALARPFAADHDLSLATLDMISSAAFGMEKSNAALTKEILCVQCFRPDAEPGPVDFPRATQGPEIEGL LDIADMVAVAQGSPFPTLAQWLALLKPKHARAHWHRRKLLRRQTAKSLHRLARVGEKVVSQSALDELLRREKMAA AKAGRAPDFYSPAIRDEVLGYLLGGHDTTSTLLAWWVKYMTRHQDVQARLRSAIRQGHSDALAEGRWPTMTEIVS ASIPYLDAVLEESLRCASVATLIVRKATRDTQILGYSVPEGTDVIIPLTGPSFTEPALDIPESLRSEACRNARDR VPAWGDDVGEFRPQRWLKDETGAAGETVEAFDPQAGPSLAFSSGPRQCFGRKQAYLQLRTTVTLLLWSFAFDPVD EALDGWEITESLVNLPKVCYVQLRKL* |
| Coding | >Hirsu2|5414 CTGTGGACCCTGAAGCAGTCGAGGGCCCTCGCGCGGCCCTTCGCGGCCGACCACGACCTGAGCCTGGCCACCCTC GACATGATCTCGAGCGCGGCCTTCGGCATGGAGAAATCCAACGCCGCCCTCACCAAGGAAATTCTTTGCGTCCAG TGCTTCCGCCCAGACGCCGAGCCCGGCCCCGTCGACTTCCCCCGTGCCACCCAGGGCCCGGAAATCGAGGGCCTA CTCGACATCGCCGACATGGTGGCCGTCGCCCAGGGCAGTCCCTTCCCGACCCTCGCCCAGTGGCTGGCCCTGCTC AAGCCCAAGCACGCCCGCGCCCACTGGCACCGGCGCAAGCTCCTCCGCCGTCAGACGGCCAAGAGCCTGCACCGC CTCGCCCGCGTCGGCGAGAAGGTGGTGTCGCAGAGCGCCCTCGACGAGCTCCTCCGCCGCGAGAAGATGGCGGCC GCCAAGGCGGGCAGGGCCCCGGACTTTTACTCGCCGGCCATCAGGGACGAGGTCCTCGGCTACTTGCTCGGAGGT CACGACACCACGTCCACGCTCCTGGCCTGGTGGGTCAAGTACATGACGCGCCACCAGGACGTGCAGGCTCGCCTG CGGAGCGCCATCCGCCAGGGCCATTCGGACGCCCTCGCCGAGGGCCGGTGGCCGACCATGACGGAGATTGTGTCG GCGTCGATCCCCTACCTCGACGCCGTCCTGGAAGAGTCGCTCCGCTGCGCGTCGGTGGCGACGCTGATCGTGCGC AAGGCCACGCGCGACACCCAGATCCTCGGCTACTCCGTCCCCGAGGGCACCGACGTCATCATCCCGCTGACGGGG CCCTCCTTCACCGAGCCGGCCCTGGACATCCCCGAGTCGCTGCGGTCCGAGGCCTGCCGCAACGCCAGGGACCGC GTGCCCGCCTGGGGCGACGACGTGGGCGAGTTCAGGCCGCAGCGCTGGCTCAAGGACGAGACGGGCGCCGCCGGC GAGACGGTCGAGGCCTTCGATCCGCAGGCCGGGCCCAGCCTGGCCTTCTCGAGCGGGCCGAGGCAGTGCTTCGGC CGGAAGCAGGCGTACCTGCAGCTGCGCACGACGGTGACGCTACTGCTGTGGAGCTTCGCCTTCGACCCTGTCGAC GAGGCGCTCGACGGCTGGGAGATTACCGAGAGCCTCGTCAACCTGCCCAAGGTCTGCTACGTCCAGCTGCGAAAG CTATGA |
| Transcript | >Hirsu2|5414 CTGTGGACCCTGAAGCAGTCGAGGGCCCTCGCGCGGCCCTTCGCGGCCGACCACGACCTGAGCCTGGCCACCCTC GACATGATCTCGAGCGCGGCCTTCGGCATGGAGAAATCCAACGCCGCCCTCACCAAGGAAATTCTTTGCGTCCAG TGCTTCCGCCCAGACGCCGAGCCCGGCCCCGTCGACTTCCCCCGTGCCACCCAGGGCCCGGAAATCGAGGGCCTA CTCGACATCGCCGACATGGTGGCCGTCGCCCAGGGCAGTCCCTTCCCGACCCTCGCCCAGTGGCTGGCCCTGCTC AAGCCCAAGCACGCCCGCGCCCACTGGCACCGGCGCAAGCTCCTCCGCCGTCAGACGGCCAAGAGCCTGCACCGC CTCGCCCGCGTCGGCGAGAAGGTGGTGTCGCAGAGCGCCCTCGACGAGCTCCTCCGCCGCGAGAAGATGGCGGCC GCCAAGGCGGGCAGGGCCCCGGACTTTTACTCGCCGGCCATCAGGGACGAGGTCCTCGGCTACTTGCTCGGAGGT CACGACACCACGTCCACGCTCCTGGCCTGGTGGGTCAAGTACATGACGCGCCACCAGGACGTGCAGGCTCGCCTG CGGAGCGCCATCCGCCAGGGCCATTCGGACGCCCTCGCCGAGGGCCGGTGGCCGACCATGACGGAGATTGTGTCG GCGTCGATCCCCTACCTCGACGCCGTCCTGGAAGAGTCGCTCCGCTGCGCGTCGGTGGCGACGCTGATCGTGCGC AAGGCCACGCGCGACACCCAGATCCTCGGCTACTCCGTCCCCGAGGGCACCGACGTCATCATCCCGCTGACGGGG CCCTCCTTCACCGAGCCGGCCCTGGACATCCCCGAGTCGCTGCGGTCCGAGGCCTGCCGCAACGCCAGGGACCGC GTGCCCGCCTGGGGCGACGACGTGGGCGAGTTCAGGCCGCAGCGCTGGCTCAAGGACGAGACGGGCGCCGCCGGC GAGACGGTCGAGGCCTTCGATCCGCAGGCCGGGCCCAGCCTGGCCTTCTCGAGCGGGCCGAGGCAGTGCTTCGGC CGGAAGCAGGCGTACCTGCAGCTGCGCACGACGGTGACGCTACTGCTGTGGAGCTTCGCCTTCGACCCTGTCGAC GAGGCGCTCGACGGCTGGGAGATTACCGAGAGCCTCGTCAACCTGCCCAAGGTCTGCTACGTCCAGCTGCGAAAG CTATGA |
| Gene | >Hirsu2|5414 CTGTGGACCCTGAAGCAGTCGAGGGCCCTCGCGCGGCCCTTCGCGGCCGACCACGACCTGAGCCTGGCCACCCTC GACATGATCTCGAGCGCGGCCTTCGGCATGGAGAAATCCAACGCCGCCCTCACCAAGGAAATTCTTTGCGTCCAG TGCTTCCGCCCAGACGCCGAGCCCGGCCCCGTCGACTTCCCCCGTGCCACCCAGGGCCCGGAAATCGAGGGCCTA CTCGACATCGCCGACATGGTGGCCGTCGCCCAGGGCAGTCCCTTCCCGACCCTCGCCCAGTGGCTGGCCCTGCTC AAGCCCAAGCACGCCCGCGCCCACTGGCACCGGCGCAAGCTCCTCCGCCGTCAGACGGCCAAGAGCCTGCACCGC CTCGCCCGCGTCGGCGAGAAGGTGGTGTCGCAGAGCGCCCTCGACGAGCTCCTCCGCCGCGAGAAGATGGCGGCC GCCAAGGCGGGCAGGGCCCCGGACTTTTACTCGCCGGCCATCAGGGACGAGGTACGCGCGCGCGAGATGTGCCGT CCTGCCGACGACAGCTGCTGACTCGCAACTTCACAGGTCCTCGGCTACTTGCTCGGAGGTCACGACACCACGTCC ACGCTCCTGGCCTGGTGGGTCAAGTACATGACGCGCCACCAGGACGTGCAGGCTCGCCTGCGGAGCGCCATCCGC CAGGGCCATTCGGACGCCCTCGCCGAGGGCCGGTGGCCGACCATGACGGAGATTGTGTCGGCGTCGATCCCCTAC CTCGACGCCGTCCTGGAAGAGTCGCTCCGCTGCGCGTCGGTGGCGACGCTGATCGTGCGCAAGGCCACGCGCGAC ACCCAGATCCTCGGCTACTCCGTCCCCGAGGGCACCGACGTCATCATCCCGCTGACGGGGCCCTCCTTCACCGAG CCGGCCCTGGACATCCCCGAGTCGCTGCGGTCCGAGGCCTGCCGCAACGCCAGGGACCGCGTGCCCGCCTGGGGC GACGACGTGGGCGAGTTCAGGCCGCAGCGCTGGCTCAAGGACGAGACGGGCGCCGCCGGCGAGACGGTCGAGGCC TTCGATCCGCAGGCCGGGCCCAGCCTGGCCTTCTCGAGCGGGCCGAGGCAGTGCTTCGGCCGGAAGCAGGCGTAC CTGCAGCTGCGCACGACGGTGACGCTACTGCTGTGGAGCTTCGCCTTCGACCCTGTCGACGAGGCGCTCGACGGC TGGGAGATTACCGAGAGCCTCGTCAACCTGCCCAAGGTCTGCTACGTCCAGCTGCGAAAGCTATGA |