Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5412
Gene name
LocationContig_2704:309..945
Strand+
Gene length (bp)636
Transcript length (bp)321
Coding sequence length (bp)321
Protein length (aa) 107

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q524W4|ATG18_MAGO7 Autophagy-related protein 18 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG18 PE=3 SV=1 1 95 3.0E-54
sp|Q96U88|ATG18_NEUCR Autophagy-related protein 18 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-10 PE=3 SV=2 1 95 5.0E-50
sp|Q2GV40|ATG18_CHAGB Autophagy-related protein 18 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG18 PE=3 SV=1 6 94 7.0E-48
sp|A6SJ85|ATG18_BOTFB Autophagy-related protein 18 OS=Botryotinia fuckeliana (strain B05.10) GN=atg18 PE=3 SV=2 6 95 1.0E-46
sp|A7EW77|ATG18_SCLS1 Autophagy-related protein 18 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg18 PE=3 SV=1 6 95 6.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q524W4|ATG18_MAGO7 Autophagy-related protein 18 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG18 PE=3 SV=1 1 95 3.0E-54
sp|Q96U88|ATG18_NEUCR Autophagy-related protein 18 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-10 PE=3 SV=2 1 95 5.0E-50
sp|Q2GV40|ATG18_CHAGB Autophagy-related protein 18 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG18 PE=3 SV=1 6 94 7.0E-48
sp|A6SJ85|ATG18_BOTFB Autophagy-related protein 18 OS=Botryotinia fuckeliana (strain B05.10) GN=atg18 PE=3 SV=2 6 95 1.0E-46
sp|A7EW77|ATG18_SCLS1 Autophagy-related protein 18 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg18 PE=3 SV=1 6 95 6.0E-46
sp|Q1DKJ3|ATG18_COCIM Autophagy-related protein 18 OS=Coccidioides immitis (strain RS) GN=ATG18 PE=3 SV=1 5 95 5.0E-41
sp|Q5BH53|ATG18_EMENI Autophagy-related protein 18 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg18 PE=3 SV=2 5 95 2.0E-39
sp|A2RAG5|ATG18_ASPNC Autophagy-related protein 18 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg18 PE=3 SV=1 5 95 3.0E-39
sp|Q0CW30|ATG18_ASPTN Autophagy-related protein 18 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg18 PE=3 SV=1 5 95 7.0E-39
sp|A7KAM8|ATG18_PENRW Autophagy-related protein 18 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg18 PE=3 SV=1 5 95 9.0E-39
sp|A1DE24|ATG18_NEOFI Autophagy-related protein 18 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg18 PE=3 SV=1 5 95 2.0E-38
sp|Q2U6D5|ATG18_ASPOR Autophagy-related protein 18 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg18 PE=3 SV=1 5 95 2.0E-38
sp|A1CBB8|ATG18_ASPCL Autophagy-related protein 18 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg18 PE=3 SV=1 5 95 1.0E-37
sp|Q4WVD0|ATG18_ASPFU Autophagy-related protein 18 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg18 PE=3 SV=1 5 95 2.0E-37
sp|Q0U2J8|ATG18_PHANO Autophagy-related protein 18 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG18 PE=3 SV=2 6 95 1.0E-32
sp|Q6C044|ATG18_YARLI Autophagy-related protein 18 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG18 PE=3 SV=1 3 95 3.0E-32
sp|Q5QA94|ATG18_PICAN Autophagy-related protein 18 OS=Pichia angusta GN=ATG18 PE=3 SV=1 5 95 8.0E-32
sp|P43601|ATG18_YEAST Autophagy-related protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG18 PE=1 SV=1 2 95 1.0E-31
sp|A7A258|ATG18_YEAS7 Autophagy-related protein 18 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG18 PE=3 SV=1 2 95 1.0E-31
sp|Q75F47|ATG18_ASHGO Autophagy-related protein 18 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG18 PE=3 SV=1 4 95 2.0E-30
sp|Q6CS21|ATG18_KLULA Autophagy-related protein 18 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG18 PE=3 SV=1 4 102 3.0E-30
sp|Q4P4N1|ATG18_USTMA Autophagy-related protein 18 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ATG18 PE=3 SV=1 9 95 4.0E-28
sp|Q8X1F5|ATG18_PICPA Autophagy-related protein 18 OS=Komagataella pastoris GN=ATG18 PE=3 SV=1 5 95 7.0E-28
sp|A5DHI9|ATG18_PICGU Autophagy-related protein 18 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG18 PE=3 SV=2 3 95 8.0E-27
sp|Q6FM63|ATG18_CANGA Autophagy-related protein 18 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG18 PE=3 SV=1 5 102 4.0E-26
sp|P0CS28|ATG18_CRYNJ Autophagy-related protein 18 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG18 PE=3 SV=1 4 95 7.0E-26
sp|P0CS29|ATG18_CRYNB Autophagy-related protein 18 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG18 PE=3 SV=1 4 95 7.0E-26
sp|A6QTX7|ATG18_AJECN Autophagy-related protein 18 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ATG18 PE=3 SV=1 5 95 1.0E-25
sp|A7TPY4|ATG18_VANPO Autophagy-related protein 18 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG18 PE=3 SV=2 4 101 2.0E-25
sp|Q5QJC0|ATG21_PICAN Autophagy-related protein 21 OS=Pichia angusta GN=ATG21 PE=3 SV=1 5 95 2.0E-24
sp|A3GFE3|ATG18_PICST Autophagy-related protein 18 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG18 PE=3 SV=2 5 95 1.0E-21
sp|Q6BIL4|ATG18_DEBHA Autophagy-related protein 18 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG18 PE=3 SV=1 2 95 3.0E-21
sp|Q54NA2|ATG18_DICDI Autophagy-related protein 18 OS=Dictyostelium discoideum GN=atg18 PE=3 SV=1 8 95 1.0E-20
sp|Q9HDZ7|ATG18_SCHPO Autophagy-related protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg18 PE=1 SV=1 18 95 1.0E-19
sp|Q5ABA6|ATG18_CANAL Autophagy-related protein 18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG18 PE=3 SV=1 6 95 6.0E-19
sp|Q93VB2|AT18A_ARATH Autophagy-related protein 18a OS=Arabidopsis thaliana GN=ATG18A PE=1 SV=1 1 95 1.0E-18
sp|Q0WPK3|AT18D_ARATH Autophagy-related protein 18d OS=Arabidopsis thaliana GN=ATG18D PE=2 SV=1 9 102 2.0E-16
sp|Q6CLZ2|ATG21_KLULA Autophagy-related protein 21 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ATG21 PE=3 SV=1 5 94 6.0E-16
sp|Q8GYD7|AT18C_ARATH Autophagy-related protein 18c OS=Arabidopsis thaliana GN=ATG18C PE=2 SV=1 9 102 6.0E-15
sp|A5DVU7|ATG18_LODEL Autophagy-related protein 18 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=ATG18 PE=3 SV=1 1 93 3.0E-14
sp|Q6BIA1|ATG21_DEBHA Autophagy-related protein 21 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG21 PE=3 SV=2 6 95 7.0E-14
sp|Q5ZHN3|WIPI2_CHICK WD repeat domain phosphoinositide-interacting protein 2 OS=Gallus gallus GN=WIPI2 PE=2 SV=1 2 102 9.0E-14
sp|Q80W47|WIPI2_MOUSE WD repeat domain phosphoinositide-interacting protein 2 OS=Mus musculus GN=Wipi2 PE=1 SV=1 2 102 1.0E-13
sp|Q7ZWU5|WIPI2_XENLA WD repeat domain phosphoinositide-interacting protein 2 OS=Xenopus laevis GN=wipi2 PE=2 SV=1 8 102 3.0E-13
sp|Q6AY57|WIPI2_RAT WD repeat domain phosphoinositide-interacting protein 2 OS=Rattus norvegicus GN=Wipi2 PE=1 SV=1 6 95 5.0E-13
sp|Q9P6N1|MG179_SCHPO Autophagy-related protein 21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug179 PE=1 SV=1 8 95 6.0E-13
sp|Q5AI22|ATG21_CANAL Autophagy-related protein 21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG21 PE=3 SV=1 5 95 6.0E-13
sp|Q75D34|ATG21_ASHGO Autophagy-related protein 21 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ATG21 PE=3 SV=2 6 95 3.0E-12
sp|A7TTC8|ATG21_VANPO Autophagy-related protein 21 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG21 PE=3 SV=1 11 95 5.0E-12
sp|Q8H1Q8|AT18B_ARATH Autophagy-related protein 18b OS=Arabidopsis thaliana GN=ATG18B PE=2 SV=2 9 95 1.0E-10
sp|Q6FRU4|ATG21_CANGA Autophagy-related protein 21 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ATG21 PE=3 SV=1 6 95 1.0E-10
sp|Q640T2|WIPI3_XENTR WD repeat domain phosphoinositide-interacting protein 3 OS=Xenopus tropicalis GN=wdr45b PE=2 SV=1 6 95 1.0E-10
sp|Q68F45|WIPI3_XENLA WD repeat domain phosphoinositide-interacting protein 3 OS=Xenopus laevis GN=wdr45b PE=2 SV=1 11 95 1.0E-10
sp|Q9CR39|WIPI3_MOUSE WD repeat domain phosphoinositide-interacting protein 3 OS=Mus musculus GN=Wdr45b PE=1 SV=2 6 95 3.0E-10
sp|Q5R7W0|WIPI3_PONAB WD repeat domain phosphoinositide-interacting protein 3 OS=Pongo abelii GN=WDR45B PE=2 SV=1 6 95 3.0E-10
sp|Q5MNZ6|WIPI3_HUMAN WD repeat domain phosphoinositide-interacting protein 3 OS=Homo sapiens GN=WDR45B PE=2 SV=2 6 95 3.0E-10
sp|Q7ZUW6|WIPI3_DANRE WD repeat domain phosphoinositide-interacting protein 3 OS=Danio rerio GN=wdr45b PE=2 SV=1 6 95 4.0E-10
sp|Q5ZL16|WIPI3_CHICK WD repeat domain phosphoinositide-interacting protein 3 OS=Gallus gallus GN=WDR45B PE=2 SV=1 6 95 1.0E-09
sp|Q9Y4P8|WIPI2_HUMAN WD repeat domain phosphoinositide-interacting protein 2 OS=Homo sapiens GN=WIPI2 PE=1 SV=1 6 95 3.0E-09
sp|Q6CEI9|HSV2_YARLI SVP1-like protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HSV2 PE=3 SV=1 4 102 1.0E-08
sp|Q8R3E3|WIPI1_MOUSE WD repeat domain phosphoinositide-interacting protein 1 OS=Mus musculus GN=Wipi1 PE=1 SV=1 5 102 3.0E-08
sp|A6ZWF0|ATG21_YEAS7 Autophagy-related protein 21 OS=Saccharomyces cerevisiae (strain YJM789) GN=ATG21 PE=3 SV=1 47 95 5.0E-08
sp|Q5MNZ9|WIPI1_HUMAN WD repeat domain phosphoinositide-interacting protein 1 OS=Homo sapiens GN=WIPI1 PE=1 SV=3 5 102 6.0E-08
sp|Q6CN23|HSV2_KLULA SVP1-like protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HSV2 PE=1 SV=1 1 94 2.0E-07
sp|Q02887|ATG21_YEAST Autophagy-related protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATG21 PE=1 SV=1 47 95 2.0E-07
sp|Q5U2Y0|WIPI4_RAT WD repeat domain phosphoinositide-interacting protein 4 OS=Rattus norvegicus GN=Wdr45 PE=2 SV=1 11 102 5.0E-07
sp|Q91VM3|WIPI4_MOUSE WD repeat domain phosphoinositide-interacting protein 4 OS=Mus musculus GN=Wdr45 PE=1 SV=1 11 102 1.0E-06
sp|Q7ZUX3|WIPI4_DANRE WD repeat domain phosphoinositide-interacting protein 4 OS=Danio rerio GN=wdr45 PE=2 SV=1 6 102 2.0E-06
sp|Q7SG97|HSV2_NEUCR SVP1-like protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-14 PE=3 SV=2 3 95 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 45 67 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5412
MASPSLNFITFNQDHSCLAVGTSRGFRIYHTEPFSRIFSSDDGNIAIIEMLFSTSLVAIILSPRHLIIQNTKRAS
VICELTFPSAVLAVRLNRKRPHISLRHPAKF*
Coding >Hirsu2|5412
ATGGCCAGCCCGTCGCTCAACTTCATCACATTTAACCAGGATCATAGCTGCCTCGCCGTCGGAACCTCTAGGGGC
TTTCGAATCTACCATACCGAACCCTTTTCCAGAATATTTAGTAGTGATGATGGAAACATCGCTATCATCGAGATG
TTGTTTTCAACGTCGCTCGTCGCCATCATTTTATCACCACGTCATTTGATCATACAGAATACCAAGAGGGCATCC
GTCATCTGCGAACTCACGTTCCCCTCCGCTGTTCTCGCCGTTCGCCTGAACAGGAAGCGTCCACATATATCGCTC
CGACATCCGGCGAAGTTCTAG
Transcript >Hirsu2|5412
ATGGCCAGCCCGTCGCTCAACTTCATCACATTTAACCAGGATCATAGCTGCCTCGCCGTCGGAACCTCTAGGGGC
TTTCGAATCTACCATACCGAACCCTTTTCCAGAATATTTAGTAGTGATGATGGAAACATCGCTATCATCGAGATG
TTGTTTTCAACGTCGCTCGTCGCCATCATTTTATCACCACGTCATTTGATCATACAGAATACCAAGAGGGCATCC
GTCATCTGCGAACTCACGTTCCCCTCCGCTGTTCTCGCCGTTCGCCTGAACAGGAAGCGTCCACATATATCGCTC
CGACATCCGGCGAAGTTCTAG
Gene >Hirsu2|5412
ATGGCCAGCCCGTCGCTCAACTTCATCACATTTAACCAGGATCATAGCTGCCTCGCCGTCGGTGAGTGTCAACTC
TTGATTCCATCTCACTGGCTCTCACCTTGCCCGGAAATCTGCAGGAACCTCTAGGGGCTTTCGAATCTACCATAC
CGAACCCTTTTCCAGAATATTTAGTAGTGATGATGGAAACATCGCTATCATCGAGATGTTGTTTTCAACGTCGCT
CGTCGCCATCATTTTATCACCACGTCATTTGATCATACAGAATACCAAGGTACAGCCTCTCGTCCACCGGGGTTT
CACTCCACTTACTTGGCAACCTTGATTCTCAGAGGGCATCCGTCATCTGCGAACTCACGTTCCCCTCCGCTGTTC
TCGCCGTTCGCCTGAACAGGAAGCGGTTGGTGGTTGTTCTGGAGGAAGAAATCTACCTTTACGATATCAGCAATA
TGAGCCTTCTTTACACTATCGCTACATCTCCAAATCCGACGGCCATCTGTGCGCTGTCGCCCTCGTCCGAAAATT
GTTTCATGGCATACCCTCTGCCAAAGCCTCGCGAGGACCAAGACTCCAAACGGCCGTCTCACGCACCTCCTCAGT
CCACATATATCGCTCCGACATCCGGCGAAGTTCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail