Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5410
Gene name
LocationContig_2700:117..1498
Strand-
Gene length (bp)1381
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02002 TFIIE_alpha TFIIE alpha subunit 9.1E-15 7 104

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3W1|T2EA_SCHPO Transcription initiation factor IIE subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfa1 PE=1 SV=3 2 329 2.0E-43
sp|P36100|T2EA_YEAST Transcription initiation factor IIE subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFA1 PE=1 SV=1 2 286 1.0E-36
sp|Q557M8|T2EA_DICDI General transcription factor IIE subunit 1 OS=Dictyostelium discoideum GN=gtf2e1-1 PE=3 SV=1 7 226 7.0E-15
sp|P29083|T2EA_HUMAN General transcription factor IIE subunit 1 OS=Homo sapiens GN=GTF2E1 PE=1 SV=2 7 278 2.0E-13
sp|Q5R8H5|T2EA_PONAB General transcription factor IIE subunit 1 OS=Pongo abelii GN=GTF2E1 PE=2 SV=1 7 278 5.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3W1|T2EA_SCHPO Transcription initiation factor IIE subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tfa1 PE=1 SV=3 2 329 2.0E-43
sp|P36100|T2EA_YEAST Transcription initiation factor IIE subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFA1 PE=1 SV=1 2 286 1.0E-36
sp|Q557M8|T2EA_DICDI General transcription factor IIE subunit 1 OS=Dictyostelium discoideum GN=gtf2e1-1 PE=3 SV=1 7 226 7.0E-15
sp|P29083|T2EA_HUMAN General transcription factor IIE subunit 1 OS=Homo sapiens GN=GTF2E1 PE=1 SV=2 7 278 2.0E-13
sp|Q5R8H5|T2EA_PONAB General transcription factor IIE subunit 1 OS=Pongo abelii GN=GTF2E1 PE=2 SV=1 7 278 5.0E-13
sp|Q9D0D5|T2EA_MOUSE General transcription factor IIE subunit 1 OS=Mus musculus GN=Gtf2e1 PE=1 SV=1 7 186 4.0E-12
sp|A6QLI8|T2EA_BOVIN General transcription factor IIE subunit 1 OS=Bos taurus GN=GTF2E1 PE=2 SV=1 7 278 4.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5410
MELAVTLIKSVMRAFYATRDILVVDALMLHEALRDDDLAYLMAINTKDLHKICGKLREDRFLSVHTRQEMRPGNP
RPSNRTWYYINYRHTIDAIKWRVYTIDKEVQGSSIPANEKKEYFCTFCKAEWTAMEVLDNVGPSGFVCHRCHHTL
TFEAERNSGGHEQSTRLNDQFKFISELLPKIDAVHIPECDFDRALARARPVIRDVTHQRAATIPVESGTSRPMAV
KGLSNSGPQSIAVNISATEGPSAAEREAEKARKEHIARQNSLPSWMSNSTVTGESFSGITDTNMSAGIKGEVGGI
SIIKPVDLNTSAQIDDIFEKLKAEQAAENSQQERNPDDEELYSGEDGEDQFEDVPANDMSIFQAADVPRGAQVDS
PPGIDERPAKRVKLKTGLLDRNVLGERDEENDEELEFENV*
Coding >Hirsu2|5410
ATGGAACTTGCCGTCACACTTATCAAGTCTGTTATGCGAGCTTTCTATGCCACGCGTGATATACTCGTCGTCGAC
GCCCTGATGTTACATGAAGCTCTCCGCGATGATGACCTAGCTTATCTTATGGCAATCAATACCAAGGACCTTCAT
AAAATTTGTGGTAAACTCAGGGAGGATCGTTTTCTTTCGGTTCACACGAGGCAAGAGATGCGCCCCGGAAATCCC
AGGCCAAGCAATCGAACATGGTATTATATCAACTATCGCCACACTATTGATGCTATCAAATGGCGAGTCTACACG
ATCGACAAAGAGGTACAGGGAAGTTCAATTCCTGCGAACGAGAAAAAAGAATATTTTTGCACTTTCTGCAAGGCC
GAATGGACGGCCATGGAGGTTCTGGATAACGTCGGCCCAAGTGGCTTTGTGTGCCACCGCTGTCATCACACACTT
ACCTTCGAGGCCGAACGAAACTCTGGCGGGCACGAACAATCCACTCGCCTCAACGATCAATTCAAATTCATCAGT
GAACTTCTGCCAAAAATTGATGCTGTGCATATACCTGAGTGTGATTTCGACCGCGCTTTAGCCAGAGCACGTCCC
GTTATTCGGGACGTCACCCACCAAAGAGCGGCTACGATTCCCGTTGAAAGTGGCACAAGCCGGCCAATGGCTGTC
AAAGGCCTTAGTAACAGTGGACCACAGTCGATTGCGGTCAATATTTCTGCGACAGAGGGCCCTTCCGCGGCCGAG
CGTGAAGCTGAAAAGGCTCGAAAGGAACATATCGCGCGGCAAAATTCGCTGCCGTCATGGATGTCTAATAGCACC
GTCACCGGGGAATCTTTCTCTGGTATCACAGACACTAATATGAGCGCCGGCATCAAGGGCGAGGTCGGGGGTATC
TCGATTATTAAACCCGTGGACCTCAACACCAGTGCGCAGATTGACGACATCTTCGAGAAGCTCAAAGCTGAACAG
GCGGCTGAGAATTCACAACAAGAGAGAAATCCTGATGATGAAGAACTTTACTCCGGTGAAGACGGTGAAGATCAA
TTCGAAGACGTACCAGCTAACGACATGTCAATATTCCAGGCGGCTGACGTTCCGCGAGGAGCTCAAGTCGACTCA
CCCCCAGGCATTGATGAGAGGCCGGCTAAGCGGGTAAAGCTGAAAACCGGCTTGCTCGATCGAAACGTTCTGGGA
GAGAGGGACGAGGAAAATGACGAGGAACTCGAGTTCGAGAATGTATAA
Transcript >Hirsu2|5410
ATGGAACTTGCCGTCACACTTATCAAGTCTGTTATGCGAGCTTTCTATGCCACGCGTGATATACTCGTCGTCGAC
GCCCTGATGTTACATGAAGCTCTCCGCGATGATGACCTAGCTTATCTTATGGCAATCAATACCAAGGACCTTCAT
AAAATTTGTGGTAAACTCAGGGAGGATCGTTTTCTTTCGGTTCACACGAGGCAAGAGATGCGCCCCGGAAATCCC
AGGCCAAGCAATCGAACATGGTATTATATCAACTATCGCCACACTATTGATGCTATCAAATGGCGAGTCTACACG
ATCGACAAAGAGGTACAGGGAAGTTCAATTCCTGCGAACGAGAAAAAAGAATATTTTTGCACTTTCTGCAAGGCC
GAATGGACGGCCATGGAGGTTCTGGATAACGTCGGCCCAAGTGGCTTTGTGTGCCACCGCTGTCATCACACACTT
ACCTTCGAGGCCGAACGAAACTCTGGCGGGCACGAACAATCCACTCGCCTCAACGATCAATTCAAATTCATCAGT
GAACTTCTGCCAAAAATTGATGCTGTGCATATACCTGAGTGTGATTTCGACCGCGCTTTAGCCAGAGCACGTCCC
GTTATTCGGGACGTCACCCACCAAAGAGCGGCTACGATTCCCGTTGAAAGTGGCACAAGCCGGCCAATGGCTGTC
AAAGGCCTTAGTAACAGTGGACCACAGTCGATTGCGGTCAATATTTCTGCGACAGAGGGCCCTTCCGCGGCCGAG
CGTGAAGCTGAAAAGGCTCGAAAGGAACATATCGCGCGGCAAAATTCGCTGCCGTCATGGATGTCTAATAGCACC
GTCACCGGGGAATCTTTCTCTGGTATCACAGACACTAATATGAGCGCCGGCATCAAGGGCGAGGTCGGGGGTATC
TCGATTATTAAACCCGTGGACCTCAACACCAGTGCGCAGATTGACGACATCTTCGAGAAGCTCAAAGCTGAACAG
GCGGCTGAGAATTCACAACAAGAGAGAAATCCTGATGATGAAGAACTTTACTCCGGTGAAGACGGTGAAGATCAA
TTCGAAGACGTACCAGCTAACGACATGTCAATATTCCAGGCGGCTGACGTTCCGCGAGGAGCTCAAGTCGACTCA
CCCCCAGGCATTGATGAGAGGCCGGCTAAGCGGGTAAAGCTGAAAACCGGCTTGCTCGATCGAAACGTTCTGGGA
GAGAGGGACGAGGAAAATGACGAGGAACTCGAGTTCGAGAATGTATAA
Gene >Hirsu2|5410
ATGGAACTTGCCGTCACACTTATCAAGTCTGTTATGCGAGCTTTCTATGCCACGCGTGATATACTCGTCGTCGAC
GCCCTGATGTTACATGAAGCGTAATGTTATCAGTCCTGCTTGCAAGAACCAATCTCGATTGCGAACTAATCTTCA
TTAGCTGCCAGTCTCCGCGATGATGACCTAGCTTATCTTATGGCAATCAATACCAAGGACCTTCATAAAATTTGT
GGTAAACTCAGGGAGGATCGTTTTCTTTCGGTGTATGTTACGCTGAACCTGCGAGAGTTGTCCGCTTCGCTTCTT
CCCTCTGTTCTGACTTGGATTTAGTCACACGAGGCAAGAGATGCGCCCCGGAAATCCCAGGCCAAGCAATCGAAC
ATGGTATTATATCAACTATCGCCACACTATTGATGCTATCAAATGGCGAGTCTACACGATCGACAAAGAGGTACA
GGGAAGTTCAATTCCTGCGAACGAGAAAAAAGAATATTTTTGCACTTTCTGCAAGGCCGAATGGACGGCCATGGA
GGTTCTGGATAACGTCGGCCCAAGTGGCTTTGTGTGCCACCGCTGTCATCACACACTTACCTTCGAGGCCGAACG
AAACTCTGGCGGGCACGAACAATCCACTCGCCTCAACGATCAATTCAAATTCATCAGTGAACTTCTGCCAAAAAT
TGATGCTGTGCATATACCTGAGTGTGATTTCGACCGCGCTTTAGCCAGAGCACGTCCCGTTATTCGGGACGTCAC
CCACCAAAGAGCGGCTACGATTCCCGTTGAAAGTGGCACAAGCCGGCCAATGGCTGTCAAAGGCCTTAGTAACAG
TGGACCACAGTCGATTGCGGTCAATATTTCTGCGACAGAGGGCCCTTCCGCGGCCGAGCGTGAAGCTGAAAAGGC
TCGAAAGGAACATATCGCGCGGCAAAATTCGCTGCCGTCATGGATGTCTAATAGCACCGTCACCGGGGAATCTTT
CTCTGGTATCACAGACACTAATATGAGCGCCGGCATCAAGGGCGAGGTCGGGGGTATCTCGATTATTAAACCCGT
GGACCTCAACACCAGTGCGCAGATTGACGACATCTTCGAGAAGCTCAAAGCTGAACAGGCGGCTGAGAATTCACA
ACAAGAGAGAAATCCTGATGATGAAGAACTTTACTCCGGTGAAGACGGTGAAGATCAATTCGAAGACGTACCAGC
TAACGACATGTCAATATTCCAGGCGGCTGACGTTCCGCGAGGAGCTCAAGTCGACTCACCCCCAGGCATTGATGA
GAGGCCGGCTAAGCGGGTAAAGCTGAAAACCGGCTTGCTCGATCGAAACGTTCTGGGAGAGAGGGACGAGGAAAA
TGACGAGGAACTCGAGTTCGAGAATGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail