Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5407
Gene name
LocationContig_270:15175..15676
Strand+
Gene length (bp)501
Transcript length (bp)501
Coding sequence length (bp)501
Protein length (aa) 167

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AXK7|A0926_ARTBC Uncharacterized secreted protein ARB_00926 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00926 PE=1 SV=1 9 162 2.0E-16

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6131 0.2952 0.2292 0.0272 0.0788 0.0287 0.2403 0.1145 0.3498 0.1292

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5373
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|05447
Ophiocordyceps camponoti-rufipedis Ophun1|5179
Ophiocordyceps kimflemingae Ophio5|5396
Ophiocordyceps subramaniannii Hirsu2|5407 (this protein)
Ophiocordyceps subramaniannii Hirsu2|5421

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5407
MARQQTQGPIAGLDVSLRQSGTSPPTVTVSVTNRNRGPVTFLSYDSPLDSMALQLGLLSITPPGEAARPLELLTF
EVSRIWPPPADALISLAAGGREENEISLEEPVVPMGEIPSKASVRMSGKWQAVWPCPKDEIGEDALENLHANTDV
STGNFVSNVLEVATTR*
Coding >Hirsu2|5407
ATGGCCCGGCAGCAGACGCAGGGCCCGATCGCGGGCCTCGACGTCTCGCTGCGCCAGTCCGGCACCTCGCCGCCG
ACGGTCACGGTCAGCGTCACGAACAGGAACCGAGGCCCCGTCACCTTTCTCTCCTATGACTCGCCCCTGGACAGC
ATGGCCCTCCAGCTGGGACTTCTTTCCATCACGCCGCCTGGGGAGGCAGCCCGGCCGCTCGAGCTCCTCACCTTC
GAGGTCAGCAGGATCTGGCCGCCCCCGGCAGACGCCCTCATCAGCCTGGCGGCGGGCGGCCGTGAGGAGAACGAA
ATCAGTCTCGAAGAGCCCGTCGTGCCGATGGGCGAGATTCCCTCCAAGGCCTCGGTCCGGATGTCGGGCAAATGG
CAGGCCGTTTGGCCCTGTCCTAAGGACGAGATTGGTGAAGATGCACTGGAGAACCTGCATGCGAACACCGATGTC
TCTACCGGCAACTTTGTCTCCAACGTTCTCGAGGTCGCAACGACACGTTGA
Transcript >Hirsu2|5407
ATGGCCCGGCAGCAGACGCAGGGCCCGATCGCGGGCCTCGACGTCTCGCTGCGCCAGTCCGGCACCTCGCCGCCG
ACGGTCACGGTCAGCGTCACGAACAGGAACCGAGGCCCCGTCACCTTTCTCTCCTATGACTCGCCCCTGGACAGC
ATGGCCCTCCAGCTGGGACTTCTTTCCATCACGCCGCCTGGGGAGGCAGCCCGGCCGCTCGAGCTCCTCACCTTC
GAGGTCAGCAGGATCTGGCCGCCCCCGGCAGACGCCCTCATCAGCCTGGCGGCGGGCGGCCGTGAGGAGAACGAA
ATCAGTCTCGAAGAGCCCGTCGTGCCGATGGGCGAGATTCCCTCCAAGGCCTCGGTCCGGATGTCGGGCAAATGG
CAGGCCGTTTGGCCCTGTCCTAAGGACGAGATTGGTGAAGATGCACTGGAGAACCTGCATGCGAACACCGATGTC
TCTACCGGCAACTTTGTCTCCAACGTTCTCGAGGTCGCAACGACACGTTGA
Gene >Hirsu2|5407
ATGGCCCGGCAGCAGACGCAGGGCCCGATCGCGGGCCTCGACGTCTCGCTGCGCCAGTCCGGCACCTCGCCGCCG
ACGGTCACGGTCAGCGTCACGAACAGGAACCGAGGCCCCGTCACCTTTCTCTCCTATGACTCGCCCCTGGACAGC
ATGGCCCTCCAGCTGGGACTTCTTTCCATCACGCCGCCTGGGGAGGCAGCCCGGCCGCTCGAGCTCCTCACCTTC
GAGGTCAGCAGGATCTGGCCGCCCCCGGCAGACGCCCTCATCAGCCTGGCGGCGGGCGGCCGTGAGGAGAACGAA
ATCAGTCTCGAAGAGCCCGTCGTGCCGATGGGCGAGATTCCCTCCAAGGCCTCGGTCCGGATGTCGGGCAAATGG
CAGGCCGTTTGGCCCTGTCCTAAGGACGAGATTGGTGAAGATGCACTGGAGAACCTGCATGCGAACACCGATGTC
TCTACCGGCAACTTTGTCTCCAACGTTCTCGAGGTCGCAACGACACGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail