© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|5401 |
| Gene name | |
| Location | Contig_27:52765..54512 |
| Strand | - |
| Gene length (bp) | 1747 |
| Transcript length (bp) | 1641 |
| Coding sequence length (bp) | 1641 |
| Protein length (aa) | 547 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF07992 | Pyr_redox_2 | Pyridine nucleotide-disulphide oxidoreductase | 4.6E-50 | 135 | 440 |
| PF00355 | Rieske | Rieske [2Fe-2S] domain | 4.2E-14 | 17 | 95 |
| PF00070 | Pyr_redox | Pyridine nucleotide-disulphide oxidoreductase | 1.1E-11 | 275 | 345 |
| PF14759 | Reductase_C | Reductase C-terminal | 4.6E-07 | 461 | 534 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q10499|AIF1_SCHPO | Apoptosis-inducing factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aif1 PE=3 SV=3 | 3 | 542 | 8.0E-140 |
| sp|Q96NN9|AIFM3_HUMAN | Apoptosis-inducing factor 3 OS=Homo sapiens GN=AIFM3 PE=1 SV=1 | 15 | 534 | 4.0E-107 |
| sp|Q3TY86|AIFM3_MOUSE | Apoptosis-inducing factor 3 OS=Mus musculus GN=Aifm3 PE=1 SV=1 | 15 | 534 | 4.0E-103 |
| sp|P92947|MDAR5_ARATH | Monodehydroascorbate reductase 5, mitochondrial OS=Arabidopsis thaliana GN=MDAR5 PE=1 SV=3 | 123 | 539 | 2.0E-36 |
| sp|P16640|CAMA_PSEPU | Putidaredoxin reductase OS=Pseudomonas putida GN=camA PE=1 SV=1 | 133 | 533 | 2.0E-36 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q10499|AIF1_SCHPO | Apoptosis-inducing factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aif1 PE=3 SV=3 | 3 | 542 | 8.0E-140 |
| sp|Q96NN9|AIFM3_HUMAN | Apoptosis-inducing factor 3 OS=Homo sapiens GN=AIFM3 PE=1 SV=1 | 15 | 534 | 4.0E-107 |
| sp|Q3TY86|AIFM3_MOUSE | Apoptosis-inducing factor 3 OS=Mus musculus GN=Aifm3 PE=1 SV=1 | 15 | 534 | 4.0E-103 |
| sp|P92947|MDAR5_ARATH | Monodehydroascorbate reductase 5, mitochondrial OS=Arabidopsis thaliana GN=MDAR5 PE=1 SV=3 | 123 | 539 | 2.0E-36 |
| sp|P16640|CAMA_PSEPU | Putidaredoxin reductase OS=Pseudomonas putida GN=camA PE=1 SV=1 | 133 | 533 | 2.0E-36 |
| sp|Q84BZ0|ANDAA_BURCE | Anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Burkholderia cepacia GN=andAa PE=1 SV=1 | 134 | 535 | 7.0E-35 |
| sp|Q07946|BEDA_PSEPU | Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase subunit OS=Pseudomonas putida GN=bedA PE=1 SV=1 | 134 | 486 | 2.0E-34 |
| sp|Q40977|MDAR_PEA | Monodehydroascorbate reductase OS=Pisum sativum PE=1 SV=1 | 135 | 513 | 2.0E-34 |
| sp|P43494|THCD_RHOER | Rhodocoxin reductase OS=Rhodococcus erythropolis GN=thcD PE=1 SV=2 | 135 | 509 | 4.0E-34 |
| sp|P37337|BPHG_BURXL | Biphenyl dioxygenase system ferredoxin--NAD(+) reductase component OS=Burkholderia xenovorans (strain LB400) GN=bphG PE=3 SV=2 | 134 | 487 | 4.0E-31 |
| sp|Q9LK94|MDAR4_ARATH | Monodehydroascorbate reductase 4, peroxisomal OS=Arabidopsis thaliana GN=MDAR4 PE=1 SV=1 | 149 | 499 | 1.0E-30 |
| sp|Q43497|MDAR_SOLLC | Monodehydroascorbate reductase OS=Solanum lycopersicum GN=AFRR PE=1 SV=1 | 135 | 504 | 4.0E-30 |
| sp|A5W4E9|TODA_PSEP1 | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todA PE=1 SV=1 | 135 | 506 | 2.0E-29 |
| sp|D5IGG6|FDR_SPHSX | Ferredoxin--NAD(P)(+) reductase fdr OS=Sphingomonas sp. GN=fdr PE=1 SV=1 | 136 | 522 | 6.0E-29 |
| sp|P33009|TERPA_PSESP | Terpredoxin reductase OS=Pseudomonas sp. GN=terPA PE=4 SV=1 | 130 | 511 | 8.0E-28 |
| sp|Q9L4M8|RURE_PSEPU | Rubredoxin-NAD(+) reductase OS=Pseudomonas putida GN=alkT PE=3 SV=1 | 136 | 511 | 2.0E-27 |
| sp|Q42711|MDARS_CUCSA | Monodehydroascorbate reductase, seedling isozyme OS=Cucumis sativus PE=2 SV=1 | 159 | 504 | 3.0E-27 |
| sp|Q9LFA3|MDAR1_ARATH | Monodehydroascorbate reductase 1, peroxisomal OS=Arabidopsis thaliana GN=MDAR1 PE=1 SV=1 | 135 | 504 | 1.0E-26 |
| sp|Q9SR59|MDAR3_ARATH | Monodehydroascorbate reductase 3 OS=Arabidopsis thaliana GN=MDAR3 PE=2 SV=1 | 159 | 465 | 3.0E-26 |
| sp|P0C621|TODA_PSEPU | Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida GN=todA PE=3 SV=1 | 135 | 380 | 1.0E-25 |
| sp|P08087|BNZD_PSEPU | Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida GN=bnzD PE=3 SV=3 | 135 | 380 | 1.0E-25 |
| sp|P17052|RURE_PSEOL | Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovorans GN=alkT PE=1 SV=1 | 136 | 511 | 1.0E-25 |
| sp|B5Z115|HCAD_ECO5E | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hcaD PE=3 SV=1 | 132 | 535 | 2.0E-25 |
| sp|Q8XA71|HCAD_ECO57 | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O157:H7 GN=hcaD PE=3 SV=1 | 132 | 535 | 2.0E-25 |
| sp|Q93WJ8|MDAR2_ARATH | Monodehydroascorbate reductase 2 OS=Arabidopsis thaliana GN=MDAR2 PE=2 SV=1 | 159 | 539 | 2.0E-25 |
| sp|B1LNJ8|HCAD_ECOSM | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hcaD PE=3 SV=1 | 132 | 510 | 3.0E-24 |
| sp|B7NRJ1|HCAD_ECO7I | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hcaD PE=3 SV=1 | 132 | 510 | 6.0E-24 |
| sp|B7N6C9|HCAD_ECOLU | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hcaD PE=3 SV=1 | 132 | 510 | 2.0E-22 |
| sp|Q8L3B0|PADH_AZOEV | NADH-dependent phenylglyoxylate dehydrogenase subunit epsilon OS=Azoarcus evansii GN=padH PE=1 SV=1 | 132 | 400 | 4.0E-22 |
| sp|P42433|NASB_BACSU | Assimilatory nitrate reductase electron transfer subunit OS=Bacillus subtilis (strain 168) GN=nasB PE=2 SV=2 | 132 | 451 | 1.0E-21 |
| sp|P77650|HCAD_ECOLI | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12) GN=hcaD PE=1 SV=1 | 132 | 510 | 1.0E-21 |
| sp|B1IVT5|HCAD_ECOLC | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hcaD PE=3 SV=1 | 132 | 510 | 1.0E-21 |
| sp|A8A348|HCAD_ECOHS | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O9:H4 (strain HS) GN=hcaD PE=3 SV=1 | 132 | 510 | 1.0E-21 |
| sp|B1XB17|HCAD_ECODH | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12 / DH10B) GN=hcaD PE=3 SV=1 | 132 | 510 | 1.0E-21 |
| sp|C4ZXB7|HCAD_ECOBW | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hcaD PE=3 SV=1 | 132 | 510 | 1.0E-21 |
| sp|B6I5B5|HCAD_ECOSE | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain SE11) GN=hcaD PE=3 SV=1 | 132 | 510 | 2.0E-21 |
| sp|B7LDD4|HCAD_ECO55 | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain 55989 / EAEC) GN=hcaD PE=3 SV=1 | 132 | 510 | 2.0E-21 |
| sp|Q0S032|BPHA4_RHOJR | Biphenyl 2,3-dioxygenase, ferredoxin reductase component OS=Rhodococcus jostii (strain RHA1) GN=bphA4 PE=1 SV=1 | 150 | 533 | 2.0E-21 |
| sp|A7ZPY5|HCAD_ECO24 | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hcaD PE=3 SV=1 | 132 | 510 | 4.0E-21 |
| sp|A0KEJ2|NORW_AERHH | Nitric oxide reductase FlRd-NAD(+) reductase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=norW PE=3 SV=1 | 135 | 416 | 8.0E-21 |
| sp|Q3YZ11|HCAD_SHISS | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Shigella sonnei (strain Ss046) GN=hcaD PE=3 SV=1 | 132 | 510 | 1.0E-20 |
| sp|A4STH3|NORW_AERS4 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Aeromonas salmonicida (strain A449) GN=norW PE=3 SV=1 | 135 | 416 | 3.0E-20 |
| sp|Q9GRX6|AIFM1_DICDI | Apoptosis-inducing factor 1, mitochondrial OS=Dictyostelium discoideum GN=aif PE=2 SV=1 | 132 | 539 | 2.0E-19 |
| sp|Q58065|NAOX_METJA | Putative NADH oxidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0649 PE=3 SV=2 | 135 | 465 | 4.0E-19 |
| sp|Q7N4V5|HCAD_PHOLL | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hcaD PE=3 SV=1 | 152 | 522 | 9.0E-19 |
| sp|P42435|NASD_BACSU | Nitrite reductase [NAD(P)H] OS=Bacillus subtilis (strain 168) GN=nasD PE=2 SV=1 | 135 | 416 | 1.0E-18 |
| sp|Q9AL95|NROR_CLOAB | NADH-rubredoxin oxidoreductase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=nroR PE=1 SV=1 | 135 | 510 | 2.0E-18 |
| sp|Q0T1X7|HCAD_SHIF8 | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Shigella flexneri serotype 5b (strain 8401) GN=hcaD PE=3 SV=1 | 132 | 510 | 2.0E-18 |
| sp|P42454|RURE_ACIAD | Rubredoxin-NAD(+) reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rubB PE=1 SV=2 | 136 | 414 | 2.0E-17 |
| sp|Q9VQ79|AIFM1_DROME | Putative apoptosis-inducing factor 1, mitochondrial OS=Drosophila melanogaster GN=AIF PE=2 SV=2 | 137 | 473 | 1.0E-16 |
| sp|A8A3I8|NORW_ECOHS | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O9:H4 (strain HS) GN=norW PE=3 SV=1 | 136 | 421 | 2.0E-16 |
| sp|B5Z372|NORW_ECO5E | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=norW PE=3 SV=1 | 136 | 421 | 2.0E-16 |
| sp|Q8X850|NORW_ECO57 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 GN=norW PE=3 SV=1 | 136 | 421 | 2.0E-16 |
| sp|B2U036|NORW_SHIB3 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=norW PE=3 SV=1 | 136 | 421 | 5.0E-16 |
| sp|B7M9E8|NORW_ECO8A | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O8 (strain IAI1) GN=norW PE=3 SV=1 | 136 | 421 | 6.0E-16 |
| sp|B7LEC2|NORW_ECO55 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain 55989 / EAEC) GN=norW PE=3 SV=1 | 136 | 421 | 6.0E-16 |
| sp|Q31X75|NORW_SHIBS | Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 4 (strain Sb227) GN=norW PE=3 SV=2 | 136 | 414 | 8.0E-16 |
| sp|B7NSJ1|NORW_ECO7I | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=norW PE=3 SV=1 | 134 | 421 | 8.0E-16 |
| sp|Q0TEG9|NORW_ECOL5 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=norW PE=3 SV=1 | 136 | 421 | 9.0E-16 |
| sp|B7MYL1|NORW_ECO81 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O81 (strain ED1a) GN=norW PE=3 SV=1 | 136 | 421 | 1.0E-15 |
| sp|P37596|NORW_ECOLI | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12) GN=norW PE=1 SV=3 | 136 | 421 | 1.0E-15 |
| sp|B1IUW8|NORW_ECOLC | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=norW PE=3 SV=1 | 136 | 421 | 1.0E-15 |
| sp|B1XCN8|NORW_ECODH | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / DH10B) GN=norW PE=3 SV=1 | 136 | 421 | 1.0E-15 |
| sp|C4ZYV6|NORW_ECOBW | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=norW PE=3 SV=1 | 136 | 421 | 1.0E-15 |
| sp|A7ZQE0|NORW_ECO24 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=norW PE=3 SV=1 | 136 | 421 | 1.0E-15 |
| sp|B7UHC3|NORW_ECO27 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=norW PE=3 SV=1 | 136 | 421 | 2.0E-15 |
| sp|Q8FEN4|NORW_ECOL6 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=norW PE=3 SV=1 | 136 | 421 | 2.0E-15 |
| sp|B6I697|NORW_ECOSE | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SE11) GN=norW PE=3 SV=1 | 136 | 421 | 2.0E-15 |
| sp|Q1R7Y9|NORW_ECOUT | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain UTI89 / UPEC) GN=norW PE=3 SV=1 | 136 | 421 | 2.0E-15 |
| sp|A1AEQ1|NORW_ECOK1 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O1:K1 / APEC GN=norW PE=3 SV=1 | 136 | 421 | 2.0E-15 |
| sp|B7MKI0|NORW_ECO45 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=norW PE=3 SV=1 | 136 | 421 | 2.0E-15 |
| sp|B5XVA0|NORW_KLEP3 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae (strain 342) GN=norW PE=3 SV=1 | 134 | 421 | 3.0E-15 |
| sp|Q3YYF3|NORW_SHISS | Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella sonnei (strain Ss046) GN=norW PE=3 SV=1 | 136 | 414 | 4.0E-15 |
| sp|B1LQ29|NORW_ECOSM | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=norW PE=3 SV=1 | 134 | 421 | 5.0E-15 |
| sp|Q32CL7|NORW_SHIDS | Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=norW PE=3 SV=1 | 136 | 421 | 1.0E-14 |
| sp|P59403|NORW_SHIFL | Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri GN=norW PE=3 SV=1 | 136 | 421 | 2.0E-14 |
| sp|Q0T1D6|NORW_SHIF8 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri serotype 5b (strain 8401) GN=norW PE=3 SV=1 | 136 | 421 | 2.0E-14 |
| sp|P37062|NAPE_ENTFA | NADH peroxidase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=npr PE=1 SV=2 | 227 | 419 | 2.0E-14 |
| sp|B7LW23|NORW_ESCF3 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=norW PE=3 SV=1 | 136 | 421 | 3.0E-14 |
| sp|O95831|AIFM1_HUMAN | Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens GN=AIFM1 PE=1 SV=1 | 161 | 471 | 5.0E-14 |
| sp|A4WDR7|NORW_ENT38 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Enterobacter sp. (strain 638) GN=norW PE=3 SV=1 | 136 | 414 | 6.0E-14 |
| sp|A2RIB7|NAOX_LACLM | NADH oxidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=noxE PE=1 SV=1 | 135 | 415 | 2.0E-13 |
| sp|P75389|NAOX_MYCPN | Probable NADH oxidase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=nox PE=3 SV=1 | 203 | 449 | 3.0E-13 |
| sp|Q9Z0X1|AIFM1_MOUSE | Apoptosis-inducing factor 1, mitochondrial OS=Mus musculus GN=Aifm1 PE=1 SV=1 | 161 | 471 | 4.0E-13 |
| sp|A6TCX6|NORW_KLEP7 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=norW PE=3 SV=1 | 134 | 421 | 5.0E-13 |
| sp|Q9JM53|AIFM1_RAT | Apoptosis-inducing factor 1, mitochondrial OS=Rattus norvegicus GN=Aifm1 PE=1 SV=1 | 161 | 471 | 6.0E-13 |
| sp|A8GG95|NORW_SERP5 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Serratia proteamaculans (strain 568) GN=norW PE=3 SV=1 | 136 | 414 | 1.0E-12 |
| sp|A8ANR8|NORW_CITK8 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=norW PE=3 SV=1 | 136 | 421 | 2.0E-12 |
| sp|A9N0E0|NORW_SALPB | Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=norW PE=3 SV=1 | 136 | 414 | 2.0E-12 |
| sp|B5FSZ2|NORW_SALDC | Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella dublin (strain CT_02021853) GN=norW PE=3 SV=1 | 136 | 414 | 3.0E-12 |
| sp|B4T3B2|NORW_SALNS | Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella newport (strain SL254) GN=norW PE=3 SV=1 | 136 | 414 | 4.0E-12 |
| sp|Q49408|NAOX_MYCGE | Probable NADH oxidase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=nox PE=3 SV=1 | 197 | 449 | 5.0E-12 |
| sp|Q8ZMJ6|NORW_SALTY | Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=norW PE=3 SV=1 | 136 | 414 | 5.0E-12 |
| sp|B4TT18|NORW_SALSV | Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella schwarzengrund (strain CVM19633) GN=norW PE=3 SV=1 | 136 | 414 | 5.0E-12 |
| sp|Q8U1M0|CDR_PYRFU | Coenzyme A disulfide reductase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1186 PE=3 SV=1 | 222 | 414 | 5.0E-12 |
| sp|Q0VTB0|RURE_ALCBS | Rubredoxin-NAD(+) reductase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rubB PE=1 SV=1 | 136 | 419 | 6.0E-12 |
| sp|B5F365|NORW_SALA4 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella agona (strain SL483) GN=norW PE=3 SV=1 | 136 | 414 | 6.0E-12 |
| sp|Q9UYU5|CDR_PYRAB | Coenzyme A disulfide reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB14120 PE=3 SV=1 | 204 | 414 | 9.0E-12 |
| sp|Q8Z4C4|NORW_SALTI | Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella typhi GN=norW PE=3 SV=1 | 136 | 414 | 1.0E-11 |
| sp|B5BEP9|NORW_SALPK | Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi A (strain AKU_12601) GN=norW PE=3 SV=1 | 136 | 414 | 1.0E-11 |
| sp|Q5PF36|NORW_SALPA | Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=norW PE=3 SV=1 | 136 | 414 | 1.0E-11 |
| sp|B4TF25|NORW_SALHS | Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella heidelberg (strain SL476) GN=norW PE=3 SV=1 | 136 | 414 | 2.0E-11 |
| sp|Q8D4F7|NORW_VIBVU | Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio vulnificus (strain CMCP6) GN=norW PE=3 SV=1 | 134 | 421 | 2.0E-11 |
| sp|B5RDG6|NORW_SALG2 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=norW PE=3 SV=1 | 136 | 414 | 2.0E-11 |
| sp|Q5E3X0|NORW_VIBF1 | Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=norW PE=3 SV=2 | 136 | 414 | 2.0E-11 |
| sp|B5QV90|NORW_SALEP | Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella enteritidis PT4 (strain P125109) GN=norW PE=3 SV=1 | 136 | 414 | 3.0E-11 |
| sp|C0PWN3|NORW_SALPC | Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi C (strain RKS4594) GN=norW PE=3 SV=1 | 136 | 414 | 3.0E-11 |
| sp|Q57KT2|NORW_SALCH | Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella choleraesuis (strain SC-B67) GN=norW PE=3 SV=1 | 136 | 414 | 3.0E-11 |
| sp|Q49WB0|CDR_STAS1 | Coenzyme A disulfide reductase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cdr PE=3 SV=1 | 222 | 418 | 8.0E-11 |
| sp|B5FG80|NORW_VIBFM | Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio fischeri (strain MJ11) GN=norW PE=3 SV=1 | 136 | 414 | 8.0E-11 |
| sp|Q7MFY7|NORW_VIBVY | Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio vulnificus (strain YJ016) GN=norW PE=3 SV=1 | 134 | 421 | 2.0E-10 |
| sp|Q5XC60|NAOX_STRP6 | Probable NADH oxidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0868 PE=1 SV=1 | 135 | 415 | 4.0E-10 |
| sp|Q4L4Y7|CDR_STAHJ | Coenzyme A disulfide reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cdr PE=3 SV=1 | 208 | 418 | 5.0E-10 |
| sp|Q7A6H1|CDR_STAAN | Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain N315) GN=cdr PE=1 SV=3 | 219 | 418 | 3.0E-09 |
| sp|Q99VC0|CDR_STAAM | Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cdr PE=3 SV=3 | 219 | 418 | 3.0E-09 |
| sp|A7X0I7|CDR_STAA1 | Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=cdr PE=3 SV=1 | 219 | 418 | 3.0E-09 |
| sp|Q8NXE8|CDR_STAAW | Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MW2) GN=cdr PE=3 SV=3 | 219 | 418 | 5.0E-09 |
| sp|Q6GAV6|CDR_STAAS | Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MSSA476) GN=cdr PE=3 SV=3 | 219 | 418 | 5.0E-09 |
| sp|P22944|NIR_EMENI | Nitrite reductase [NAD(P)H] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niiA PE=3 SV=2 | 132 | 416 | 9.0E-09 |
| sp|O52582|CDR_STAA8 | Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain NCTC 8325) GN=cdr PE=1 SV=3 | 219 | 418 | 1.0E-08 |
| sp|Q6GIB7|CDR_STAAR | Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MRSA252) GN=cdr PE=3 SV=3 | 219 | 418 | 2.0E-08 |
| sp|Q5HHB4|CDR_STAAC | Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain COL) GN=cdr PE=3 SV=3 | 219 | 418 | 2.0E-08 |
| sp|A8Z076|CDR_STAAT | Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=cdr PE=3 SV=1 | 219 | 418 | 2.0E-08 |
| sp|A6QFI1|CDR_STAAE | Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Newman) GN=cdr PE=3 SV=1 | 219 | 418 | 2.0E-08 |
| sp|Q2FIA5|CDR_STAA3 | Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain USA300) GN=cdr PE=1 SV=1 | 219 | 418 | 2.0E-08 |
| sp|Q2YWW1|CDR_STAAB | Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cdr PE=3 SV=1 | 219 | 418 | 2.0E-07 |
| sp|P11959|DLDH1_GEOSE | Dihydrolipoyl dehydrogenase OS=Geobacillus stearothermophilus GN=pdhD PE=1 SV=2 | 216 | 451 | 3.0E-07 |
| sp|P08201|NIRB_ECOLI | Nitrite reductase (NADH) large subunit OS=Escherichia coli (strain K12) GN=nirB PE=3 SV=4 | 135 | 416 | 4.0E-07 |
| sp|Q5UYG6|DLDH2_HALMA | Dihydrolipoyl dehydrogenase 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=lpdA2 PE=3 SV=1 | 193 | 426 | 5.0E-07 |
| sp|Q8BUE4|AIFM2_MOUSE | Apoptosis-inducing factor 2 OS=Mus musculus GN=Aifm2 PE=1 SV=1 | 202 | 414 | 8.0E-07 |
| sp|Q7N4V8|HCAC_PHOLL | 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hcaC PE=3 SV=1 | 15 | 110 | 1.0E-06 |
| sp|D0VWY5|GASHR_MARGR | Glutathione amide reductase OS=Marichromatium gracile GN=garB PE=1 SV=1 | 208 | 413 | 2.0E-06 |
| sp|Q8GI16|CARAC_PSERE | Ferredoxin CarAc OS=Pseudomonas resinovorans GN=carAc PE=1 SV=1 | 7 | 110 | 2.0E-06 |
| sp|Q41219|LEGRE_SOYBN | Leghemoglobin reductase OS=Glycine max GN=FLBR PE=1 SV=1 | 176 | 417 | 3.0E-06 |
| sp|P37061|NAOX_ENTFA | NADH oxidase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=nox PE=1 SV=1 | 205 | 419 | 3.0E-06 |
| sp|O58308|CDR_PYRHO | Coenzyme A disulfide reductase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0572 PE=1 SV=1 | 168 | 414 | 3.0E-06 |
| sp|P21880|DLDH1_BACSU | Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=pdhD PE=3 SV=1 | 201 | 476 | 5.0E-06 |
| sp|P31023|DLDH_PEA | Dihydrolipoyl dehydrogenase, mitochondrial OS=Pisum sativum GN=LPD PE=1 SV=2 | 231 | 417 | 1.0E-05 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0051537 | 2 iron, 2 sulfur cluster binding | Yes |
| GO:0016491 | oxidoreductase activity | Yes |
| GO:0003824 | catalytic activity | No |
| GO:0005488 | binding | No |
| GO:0051540 | metal cluster binding | No |
| GO:0051536 | iron-sulfur cluster binding | No |
| GO:0003674 | molecular_function | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 47 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|5401 MAKEYRLKDVSSLSLGPGTKREVEVEGLDNAKVLLVNAAGKVQALGAKCTHYGAPLAKGVLTASGRLTCPWHGAC FNATTGDVEDAPALDALPVFSVTERDGAVYITGDEAAITGSRRKPNLRCAAAAAGAQQDKVVVVGGGSGAMGVVE GLRENGYSGPITIVSNESYLPIDRPKLSKALLTDPAKLALRDKSWFDNASIDWVEAEVNGIDFAARSVKTKQGSA FDYTKLVIATGGTPRTLPLQGFKVLGNIFTLRSVHDAKAIVGAIGDKGKKIVIIGSSFIGMEAAVATCNGNTVTV VDMSKTPLERVLGQQIGAGIQKIVEAKGVKFYLGAGIEKAEPAASDPSKVGAVCLKDGTRLEADLVILGVGVGPA TEFLRDNSILRLEQDGSIKTDEKFQVAGLKDVYAIGDIATYPYHGPGGEGKPTRIEHWNVAQNAGRAAAAHIAGR PGTGRHFIPVFWSALGAQMRYCGNPANGWDDLVLKGDPAEAKFVAYYARGETVVAMASMGMDPAMVQSAELMRRG KMPSKSQLKEGLDIMDVGVLE* |
| Coding | >Hirsu2|5401 ATGGCTAAAGAGTACAGACTCAAGGACGTCTCGTCCCTGTCTCTGGGCCCGGGCACAAAGCGGGAAGTCGAGGTC GAGGGCCTCGATAATGCCAAGGTGCTCCTCGTCAACGCCGCCGGCAAAGTCCAGGCACTGGGCGCCAAGTGCACT CACTACGGAGCTCCGCTAGCAAAGGGCGTCCTGACCGCATCGGGGCGCCTCACTTGTCCCTGGCATGGGGCTTGC TTCAATGCCACGACGGGCGATGTCGAAGACGCCCCGGCCCTTGACGCGCTCCCCGTCTTCAGCGTCACCGAGCGT GACGGAGCCGTCTACATAACCGGTGACGAAGCCGCCATCACCGGCTCCCGTCGCAAGCCCAACTTGAGATGCGCC GCCGCGGCAGCAGGTGCCCAGCAGGACAAGGTGGTCGTCGTCGGCGGCGGATCCGGCGCCATGGGCGTCGTCGAG GGCCTGCGCGAAAATGGCTACTCGGGTCCCATCACCATAGTCTCCAACGAAAGCTATCTGCCCATCGACCGGCCC AAGCTCAGCAAGGCTCTGCTCACCGACCCGGCCAAGCTGGCCTTGCGCGACAAGAGCTGGTTCGACAACGCCTCC ATCGACTGGGTCGAGGCTGAGGTCAATGGCATTGACTTCGCCGCCCGCTCCGTCAAGACCAAGCAGGGCAGCGCC TTTGACTACACAAAGCTCGTCATCGCCACGGGTGGAACGCCGAGGACGCTCCCTCTGCAGGGATTCAAGGTGCTC GGAAACATTTTTACCTTGCGGAGCGTGCACGACGCCAAGGCCATTGTCGGGGCCATCGGCGACAAGGGCAAGAAG ATTGTCATTATCGGCTCCTCCTTCATCGGCATGGAGGCGGCTGTTGCGACGTGTAACGGCAACACCGTCACCGTC GTGGACATGAGCAAGACGCCCCTGGAGCGCGTCCTCGGCCAGCAAATCGGCGCCGGCATCCAAAAGATTGTCGAG GCCAAGGGTGTCAAGTTCTACCTGGGGGCCGGCATCGAAAAGGCCGAGCCCGCCGCGTCCGATCCCTCCAAGGTG GGCGCCGTCTGCCTCAAGGACGGCACCAGGCTCGAGGCCGACCTGGTCATCCTCGGCGTCGGCGTCGGTCCCGCC ACTGAGTTTCTGCGGGACAACAGCATCTTGCGCCTGGAGCAGGACGGTTCCATCAAGACGGACGAGAAGTTCCAG GTGGCCGGGCTCAAGGACGTGTATGCCATCGGCGACATCGCCACCTACCCCTACCACGGGCCGGGCGGCGAGGGC AAGCCCACGCGCATTGAGCACTGGAACGTGGCCCAAAACGCGGGCCGCGCCGCCGCGGCCCACATCGCCGGCCGC CCGGGCACCGGCCGGCACTTCATCCCCGTCTTCTGGTCCGCCCTGGGCGCGCAGATGCGCTACTGCGGCAACCCG GCCAACGGCTGGGACGACCTGGTGCTCAAGGGCGACCCGGCCGAGGCCAAGTTCGTCGCCTACTACGCGAGGGGC GAGACGGTAGTGGCCATGGCCAGCATGGGCATGGACCCGGCCATGGTGCAGAGCGCGGAGCTGATGAGGCGAGGC AAGATGCCCAGCAAGAGCCAGCTGAAGGAGGGGCTGGACATTATGGACGTCGGCGTGCTGGAGTGA |
| Transcript | >Hirsu2|5401 ATGGCTAAAGAGTACAGACTCAAGGACGTCTCGTCCCTGTCTCTGGGCCCGGGCACAAAGCGGGAAGTCGAGGTC GAGGGCCTCGATAATGCCAAGGTGCTCCTCGTCAACGCCGCCGGCAAAGTCCAGGCACTGGGCGCCAAGTGCACT CACTACGGAGCTCCGCTAGCAAAGGGCGTCCTGACCGCATCGGGGCGCCTCACTTGTCCCTGGCATGGGGCTTGC TTCAATGCCACGACGGGCGATGTCGAAGACGCCCCGGCCCTTGACGCGCTCCCCGTCTTCAGCGTCACCGAGCGT GACGGAGCCGTCTACATAACCGGTGACGAAGCCGCCATCACCGGCTCCCGTCGCAAGCCCAACTTGAGATGCGCC GCCGCGGCAGCAGGTGCCCAGCAGGACAAGGTGGTCGTCGTCGGCGGCGGATCCGGCGCCATGGGCGTCGTCGAG GGCCTGCGCGAAAATGGCTACTCGGGTCCCATCACCATAGTCTCCAACGAAAGCTATCTGCCCATCGACCGGCCC AAGCTCAGCAAGGCTCTGCTCACCGACCCGGCCAAGCTGGCCTTGCGCGACAAGAGCTGGTTCGACAACGCCTCC ATCGACTGGGTCGAGGCTGAGGTCAATGGCATTGACTTCGCCGCCCGCTCCGTCAAGACCAAGCAGGGCAGCGCC TTTGACTACACAAAGCTCGTCATCGCCACGGGTGGAACGCCGAGGACGCTCCCTCTGCAGGGATTCAAGGTGCTC GGAAACATTTTTACCTTGCGGAGCGTGCACGACGCCAAGGCCATTGTCGGGGCCATCGGCGACAAGGGCAAGAAG ATTGTCATTATCGGCTCCTCCTTCATCGGCATGGAGGCGGCTGTTGCGACGTGTAACGGCAACACCGTCACCGTC GTGGACATGAGCAAGACGCCCCTGGAGCGCGTCCTCGGCCAGCAAATCGGCGCCGGCATCCAAAAGATTGTCGAG GCCAAGGGTGTCAAGTTCTACCTGGGGGCCGGCATCGAAAAGGCCGAGCCCGCCGCGTCCGATCCCTCCAAGGTG GGCGCCGTCTGCCTCAAGGACGGCACCAGGCTCGAGGCCGACCTGGTCATCCTCGGCGTCGGCGTCGGTCCCGCC ACTGAGTTTCTGCGGGACAACAGCATCTTGCGCCTGGAGCAGGACGGTTCCATCAAGACGGACGAGAAGTTCCAG GTGGCCGGGCTCAAGGACGTGTATGCCATCGGCGACATCGCCACCTACCCCTACCACGGGCCGGGCGGCGAGGGC AAGCCCACGCGCATTGAGCACTGGAACGTGGCCCAAAACGCGGGCCGCGCCGCCGCGGCCCACATCGCCGGCCGC CCGGGCACCGGCCGGCACTTCATCCCCGTCTTCTGGTCCGCCCTGGGCGCGCAGATGCGCTACTGCGGCAACCCG GCCAACGGCTGGGACGACCTGGTGCTCAAGGGCGACCCGGCCGAGGCCAAGTTCGTCGCCTACTACGCGAGGGGC GAGACGGTAGTGGCCATGGCCAGCATGGGCATGGACCCGGCCATGGTGCAGAGCGCGGAGCTGATGAGGCGAGGC AAGATGCCCAGCAAGAGCCAGCTGAAGGAGGGGCTGGACATTATGGACGTCGGCGTGCTGGAGTGA |
| Gene | >Hirsu2|5401 ATGGCTAAAGAGTACAGACTCAAGGACGTCTCGTCCCTGTCTCTGGGCCCGGGCACAAAGCGGGAAGTCGAGGTC GAGGGCCTCGATAATGCCAAGGTGCTCCTCGTCAACGCCGCCGGCAAAGTCCAGGCACTGGGCGCCAAGTGCACT CACTACGGAGCTCCGCTAGCAAAGGGCGTCCTGACCGCATCGGGGCGCCTCACTTGTCCCTGGCATGGGGGTAAG GCTTCCTCTCTTCCTCTTCCCCCTGACCAAGCCGTGTCCCTCCTTCTGCCTCGCATCAGCGCCCGCTCGACGGAA CCGAGACGGCTGACCGGCCCGGTTAGCTTGCTTCAATGCCACGACGGGCGATGTCGAAGACGCCCCGGCCCTTGA CGCGCTCCCCGTCTTCAGCGTCACCGAGCGTGACGGAGCCGTCTACATAACCGGTGACGAAGCCGCCATCACCGG CTCCCGTCGCAAGCCCAACTTGAGATGCGCCGCCGCGGCAGCAGGTGCCCAGCAGGACAAGGTGGTCGTCGTCGG CGGCGGATCCGGCGCCATGGGCGTCGTCGAGGGCCTGCGCGAAAATGGCTACTCGGGTCCCATCACCATAGTCTC CAACGAAAGCTATCTGCCCATCGACCGGCCCAAGCTCAGCAAGGCTCTGCTCACCGACCCGGCCAAGCTGGCCTT GCGCGACAAGAGCTGGTTCGACAACGCCTCCATCGACTGGGTCGAGGCTGAGGTCAATGGCATTGACTTCGCCGC CCGCTCCGTCAAGACCAAGCAGGGCAGCGCCTTTGACTACACAAAGCTCGTCATCGCCACGGGTGGAACGCCGAG GACGCTCCCTCTGCAGGGATTCAAGGTGCTCGGAAACATTTTTACCTTGCGGAGCGTGCACGACGCCAAGGCCAT TGTCGGGGCCATCGGCGACAAGGGCAAGAAGATTGTCATTATCGGCTCCTCCTTCATCGGCATGGAGGCGGCTGT TGCGACGTGTAACGGCAACACCGTCACCGTCGTGGACATGAGCAAGACGCCCCTGGAGCGCGTCCTCGGCCAGCA AATCGGCGCCGGCATCCAAAAGATTGTCGAGGCCAAGGGTGTCAAGTTCTACCTGGGGGCCGGCATCGAAAAGGC CGAGCCCGCCGCGTCCGATCCCTCCAAGGTGGGCGCCGTCTGCCTCAAGGACGGCACCAGGCTCGAGGCCGACCT GGTCATCCTCGGCGTCGGCGTCGGTCCCGCCACTGAGTTTCTGCGGGACAACAGCATCTTGCGCCTGGAGCAGGA CGGTTCCATCAAGACGGACGAGAAGTTCCAGGTGGCCGGGCTCAAGGACGTGTATGCCATCGGCGACATCGCCAC CTACCCCTACCACGGGCCGGGCGGCGAGGGCAAGCCCACGCGCATTGAGCACTGGAACGTGGCCCAAAACGCGGG CCGCGCCGCCGCGGCCCACATCGCCGGCCGCCCGGGCACCGGCCGGCACTTCATCCCCGTCTTCTGGTCCGCCCT GGGCGCGCAGATGCGCTACTGCGGCAACCCGGCCAACGGCTGGGACGACCTGGTGCTCAAGGGCGACCCGGCCGA GGCCAAGTTCGTCGCCTACTACGCGAGGGGCGAGACGGTAGTGGCCATGGCCAGCATGGGCATGGACCCGGCCAT GGTGCAGAGCGCGGAGCTGATGAGGCGAGGCAAGATGCCCAGCAAGAGCCAGCTGAAGGAGGGGCTGGACATTAT GGACGTCGGCGTGCTGGAGTGA |