Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5401
Gene name
LocationContig_27:52765..54512
Strand-
Gene length (bp)1747
Transcript length (bp)1641
Coding sequence length (bp)1641
Protein length (aa) 547

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 4.6E-50 135 440
PF00355 Rieske Rieske [2Fe-2S] domain 4.2E-14 17 95
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 1.1E-11 275 345
PF14759 Reductase_C Reductase C-terminal 4.6E-07 461 534

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10499|AIF1_SCHPO Apoptosis-inducing factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aif1 PE=3 SV=3 3 542 8.0E-140
sp|Q96NN9|AIFM3_HUMAN Apoptosis-inducing factor 3 OS=Homo sapiens GN=AIFM3 PE=1 SV=1 15 534 4.0E-107
sp|Q3TY86|AIFM3_MOUSE Apoptosis-inducing factor 3 OS=Mus musculus GN=Aifm3 PE=1 SV=1 15 534 4.0E-103
sp|P92947|MDAR5_ARATH Monodehydroascorbate reductase 5, mitochondrial OS=Arabidopsis thaliana GN=MDAR5 PE=1 SV=3 123 539 2.0E-36
sp|P16640|CAMA_PSEPU Putidaredoxin reductase OS=Pseudomonas putida GN=camA PE=1 SV=1 133 533 2.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10499|AIF1_SCHPO Apoptosis-inducing factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aif1 PE=3 SV=3 3 542 8.0E-140
sp|Q96NN9|AIFM3_HUMAN Apoptosis-inducing factor 3 OS=Homo sapiens GN=AIFM3 PE=1 SV=1 15 534 4.0E-107
sp|Q3TY86|AIFM3_MOUSE Apoptosis-inducing factor 3 OS=Mus musculus GN=Aifm3 PE=1 SV=1 15 534 4.0E-103
sp|P92947|MDAR5_ARATH Monodehydroascorbate reductase 5, mitochondrial OS=Arabidopsis thaliana GN=MDAR5 PE=1 SV=3 123 539 2.0E-36
sp|P16640|CAMA_PSEPU Putidaredoxin reductase OS=Pseudomonas putida GN=camA PE=1 SV=1 133 533 2.0E-36
sp|Q84BZ0|ANDAA_BURCE Anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Burkholderia cepacia GN=andAa PE=1 SV=1 134 535 7.0E-35
sp|Q07946|BEDA_PSEPU Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase subunit OS=Pseudomonas putida GN=bedA PE=1 SV=1 134 486 2.0E-34
sp|Q40977|MDAR_PEA Monodehydroascorbate reductase OS=Pisum sativum PE=1 SV=1 135 513 2.0E-34
sp|P43494|THCD_RHOER Rhodocoxin reductase OS=Rhodococcus erythropolis GN=thcD PE=1 SV=2 135 509 4.0E-34
sp|P37337|BPHG_BURXL Biphenyl dioxygenase system ferredoxin--NAD(+) reductase component OS=Burkholderia xenovorans (strain LB400) GN=bphG PE=3 SV=2 134 487 4.0E-31
sp|Q9LK94|MDAR4_ARATH Monodehydroascorbate reductase 4, peroxisomal OS=Arabidopsis thaliana GN=MDAR4 PE=1 SV=1 149 499 1.0E-30
sp|Q43497|MDAR_SOLLC Monodehydroascorbate reductase OS=Solanum lycopersicum GN=AFRR PE=1 SV=1 135 504 4.0E-30
sp|A5W4E9|TODA_PSEP1 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todA PE=1 SV=1 135 506 2.0E-29
sp|D5IGG6|FDR_SPHSX Ferredoxin--NAD(P)(+) reductase fdr OS=Sphingomonas sp. GN=fdr PE=1 SV=1 136 522 6.0E-29
sp|P33009|TERPA_PSESP Terpredoxin reductase OS=Pseudomonas sp. GN=terPA PE=4 SV=1 130 511 8.0E-28
sp|Q9L4M8|RURE_PSEPU Rubredoxin-NAD(+) reductase OS=Pseudomonas putida GN=alkT PE=3 SV=1 136 511 2.0E-27
sp|Q42711|MDARS_CUCSA Monodehydroascorbate reductase, seedling isozyme OS=Cucumis sativus PE=2 SV=1 159 504 3.0E-27
sp|Q9LFA3|MDAR1_ARATH Monodehydroascorbate reductase 1, peroxisomal OS=Arabidopsis thaliana GN=MDAR1 PE=1 SV=1 135 504 1.0E-26
sp|Q9SR59|MDAR3_ARATH Monodehydroascorbate reductase 3 OS=Arabidopsis thaliana GN=MDAR3 PE=2 SV=1 159 465 3.0E-26
sp|P0C621|TODA_PSEPU Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida GN=todA PE=3 SV=1 135 380 1.0E-25
sp|P08087|BNZD_PSEPU Benzene 1,2-dioxygenase system ferredoxin--NAD(+) reductase component OS=Pseudomonas putida GN=bnzD PE=3 SV=3 135 380 1.0E-25
sp|P17052|RURE_PSEOL Rubredoxin-NAD(+) reductase OS=Pseudomonas oleovorans GN=alkT PE=1 SV=1 136 511 1.0E-25
sp|B5Z115|HCAD_ECO5E 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=hcaD PE=3 SV=1 132 535 2.0E-25
sp|Q8XA71|HCAD_ECO57 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O157:H7 GN=hcaD PE=3 SV=1 132 535 2.0E-25
sp|Q93WJ8|MDAR2_ARATH Monodehydroascorbate reductase 2 OS=Arabidopsis thaliana GN=MDAR2 PE=2 SV=1 159 539 2.0E-25
sp|B1LNJ8|HCAD_ECOSM 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=hcaD PE=3 SV=1 132 510 3.0E-24
sp|B7NRJ1|HCAD_ECO7I 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hcaD PE=3 SV=1 132 510 6.0E-24
sp|B7N6C9|HCAD_ECOLU 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hcaD PE=3 SV=1 132 510 2.0E-22
sp|Q8L3B0|PADH_AZOEV NADH-dependent phenylglyoxylate dehydrogenase subunit epsilon OS=Azoarcus evansii GN=padH PE=1 SV=1 132 400 4.0E-22
sp|P42433|NASB_BACSU Assimilatory nitrate reductase electron transfer subunit OS=Bacillus subtilis (strain 168) GN=nasB PE=2 SV=2 132 451 1.0E-21
sp|P77650|HCAD_ECOLI 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12) GN=hcaD PE=1 SV=1 132 510 1.0E-21
sp|B1IVT5|HCAD_ECOLC 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hcaD PE=3 SV=1 132 510 1.0E-21
sp|A8A348|HCAD_ECOHS 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O9:H4 (strain HS) GN=hcaD PE=3 SV=1 132 510 1.0E-21
sp|B1XB17|HCAD_ECODH 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12 / DH10B) GN=hcaD PE=3 SV=1 132 510 1.0E-21
sp|C4ZXB7|HCAD_ECOBW 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hcaD PE=3 SV=1 132 510 1.0E-21
sp|B6I5B5|HCAD_ECOSE 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain SE11) GN=hcaD PE=3 SV=1 132 510 2.0E-21
sp|B7LDD4|HCAD_ECO55 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli (strain 55989 / EAEC) GN=hcaD PE=3 SV=1 132 510 2.0E-21
sp|Q0S032|BPHA4_RHOJR Biphenyl 2,3-dioxygenase, ferredoxin reductase component OS=Rhodococcus jostii (strain RHA1) GN=bphA4 PE=1 SV=1 150 533 2.0E-21
sp|A7ZPY5|HCAD_ECO24 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hcaD PE=3 SV=1 132 510 4.0E-21
sp|A0KEJ2|NORW_AERHH Nitric oxide reductase FlRd-NAD(+) reductase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=norW PE=3 SV=1 135 416 8.0E-21
sp|Q3YZ11|HCAD_SHISS 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Shigella sonnei (strain Ss046) GN=hcaD PE=3 SV=1 132 510 1.0E-20
sp|A4STH3|NORW_AERS4 Nitric oxide reductase FlRd-NAD(+) reductase OS=Aeromonas salmonicida (strain A449) GN=norW PE=3 SV=1 135 416 3.0E-20
sp|Q9GRX6|AIFM1_DICDI Apoptosis-inducing factor 1, mitochondrial OS=Dictyostelium discoideum GN=aif PE=2 SV=1 132 539 2.0E-19
sp|Q58065|NAOX_METJA Putative NADH oxidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0649 PE=3 SV=2 135 465 4.0E-19
sp|Q7N4V5|HCAD_PHOLL 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hcaD PE=3 SV=1 152 522 9.0E-19
sp|P42435|NASD_BACSU Nitrite reductase [NAD(P)H] OS=Bacillus subtilis (strain 168) GN=nasD PE=2 SV=1 135 416 1.0E-18
sp|Q9AL95|NROR_CLOAB NADH-rubredoxin oxidoreductase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=nroR PE=1 SV=1 135 510 2.0E-18
sp|Q0T1X7|HCAD_SHIF8 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin--NAD(+) reductase component OS=Shigella flexneri serotype 5b (strain 8401) GN=hcaD PE=3 SV=1 132 510 2.0E-18
sp|P42454|RURE_ACIAD Rubredoxin-NAD(+) reductase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rubB PE=1 SV=2 136 414 2.0E-17
sp|Q9VQ79|AIFM1_DROME Putative apoptosis-inducing factor 1, mitochondrial OS=Drosophila melanogaster GN=AIF PE=2 SV=2 137 473 1.0E-16
sp|A8A3I8|NORW_ECOHS Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O9:H4 (strain HS) GN=norW PE=3 SV=1 136 421 2.0E-16
sp|B5Z372|NORW_ECO5E Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=norW PE=3 SV=1 136 421 2.0E-16
sp|Q8X850|NORW_ECO57 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O157:H7 GN=norW PE=3 SV=1 136 421 2.0E-16
sp|B2U036|NORW_SHIB3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=norW PE=3 SV=1 136 421 5.0E-16
sp|B7M9E8|NORW_ECO8A Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O8 (strain IAI1) GN=norW PE=3 SV=1 136 421 6.0E-16
sp|B7LEC2|NORW_ECO55 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain 55989 / EAEC) GN=norW PE=3 SV=1 136 421 6.0E-16
sp|Q31X75|NORW_SHIBS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella boydii serotype 4 (strain Sb227) GN=norW PE=3 SV=2 136 414 8.0E-16
sp|B7NSJ1|NORW_ECO7I Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=norW PE=3 SV=1 134 421 8.0E-16
sp|Q0TEG9|NORW_ECOL5 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=norW PE=3 SV=1 136 421 9.0E-16
sp|B7MYL1|NORW_ECO81 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O81 (strain ED1a) GN=norW PE=3 SV=1 136 421 1.0E-15
sp|P37596|NORW_ECOLI Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12) GN=norW PE=1 SV=3 136 421 1.0E-15
sp|B1IUW8|NORW_ECOLC Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=norW PE=3 SV=1 136 421 1.0E-15
sp|B1XCN8|NORW_ECODH Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / DH10B) GN=norW PE=3 SV=1 136 421 1.0E-15
sp|C4ZYV6|NORW_ECOBW Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=norW PE=3 SV=1 136 421 1.0E-15
sp|A7ZQE0|NORW_ECO24 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=norW PE=3 SV=1 136 421 1.0E-15
sp|B7UHC3|NORW_ECO27 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=norW PE=3 SV=1 136 421 2.0E-15
sp|Q8FEN4|NORW_ECOL6 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=norW PE=3 SV=1 136 421 2.0E-15
sp|B6I697|NORW_ECOSE Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SE11) GN=norW PE=3 SV=1 136 421 2.0E-15
sp|Q1R7Y9|NORW_ECOUT Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain UTI89 / UPEC) GN=norW PE=3 SV=1 136 421 2.0E-15
sp|A1AEQ1|NORW_ECOK1 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O1:K1 / APEC GN=norW PE=3 SV=1 136 421 2.0E-15
sp|B7MKI0|NORW_ECO45 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=norW PE=3 SV=1 136 421 2.0E-15
sp|B5XVA0|NORW_KLEP3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae (strain 342) GN=norW PE=3 SV=1 134 421 3.0E-15
sp|Q3YYF3|NORW_SHISS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella sonnei (strain Ss046) GN=norW PE=3 SV=1 136 414 4.0E-15
sp|B1LQ29|NORW_ECOSM Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=norW PE=3 SV=1 134 421 5.0E-15
sp|Q32CL7|NORW_SHIDS Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=norW PE=3 SV=1 136 421 1.0E-14
sp|P59403|NORW_SHIFL Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri GN=norW PE=3 SV=1 136 421 2.0E-14
sp|Q0T1D6|NORW_SHIF8 Nitric oxide reductase FlRd-NAD(+) reductase OS=Shigella flexneri serotype 5b (strain 8401) GN=norW PE=3 SV=1 136 421 2.0E-14
sp|P37062|NAPE_ENTFA NADH peroxidase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=npr PE=1 SV=2 227 419 2.0E-14
sp|B7LW23|NORW_ESCF3 Nitric oxide reductase FlRd-NAD(+) reductase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=norW PE=3 SV=1 136 421 3.0E-14
sp|O95831|AIFM1_HUMAN Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens GN=AIFM1 PE=1 SV=1 161 471 5.0E-14
sp|A4WDR7|NORW_ENT38 Nitric oxide reductase FlRd-NAD(+) reductase OS=Enterobacter sp. (strain 638) GN=norW PE=3 SV=1 136 414 6.0E-14
sp|A2RIB7|NAOX_LACLM NADH oxidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=noxE PE=1 SV=1 135 415 2.0E-13
sp|P75389|NAOX_MYCPN Probable NADH oxidase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=nox PE=3 SV=1 203 449 3.0E-13
sp|Q9Z0X1|AIFM1_MOUSE Apoptosis-inducing factor 1, mitochondrial OS=Mus musculus GN=Aifm1 PE=1 SV=1 161 471 4.0E-13
sp|A6TCX6|NORW_KLEP7 Nitric oxide reductase FlRd-NAD(+) reductase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=norW PE=3 SV=1 134 421 5.0E-13
sp|Q9JM53|AIFM1_RAT Apoptosis-inducing factor 1, mitochondrial OS=Rattus norvegicus GN=Aifm1 PE=1 SV=1 161 471 6.0E-13
sp|A8GG95|NORW_SERP5 Nitric oxide reductase FlRd-NAD(+) reductase OS=Serratia proteamaculans (strain 568) GN=norW PE=3 SV=1 136 414 1.0E-12
sp|A8ANR8|NORW_CITK8 Nitric oxide reductase FlRd-NAD(+) reductase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=norW PE=3 SV=1 136 421 2.0E-12
sp|A9N0E0|NORW_SALPB Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=norW PE=3 SV=1 136 414 2.0E-12
sp|B5FSZ2|NORW_SALDC Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella dublin (strain CT_02021853) GN=norW PE=3 SV=1 136 414 3.0E-12
sp|B4T3B2|NORW_SALNS Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella newport (strain SL254) GN=norW PE=3 SV=1 136 414 4.0E-12
sp|Q49408|NAOX_MYCGE Probable NADH oxidase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=nox PE=3 SV=1 197 449 5.0E-12
sp|Q8ZMJ6|NORW_SALTY Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=norW PE=3 SV=1 136 414 5.0E-12
sp|B4TT18|NORW_SALSV Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella schwarzengrund (strain CVM19633) GN=norW PE=3 SV=1 136 414 5.0E-12
sp|Q8U1M0|CDR_PYRFU Coenzyme A disulfide reductase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1186 PE=3 SV=1 222 414 5.0E-12
sp|Q0VTB0|RURE_ALCBS Rubredoxin-NAD(+) reductase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rubB PE=1 SV=1 136 419 6.0E-12
sp|B5F365|NORW_SALA4 Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella agona (strain SL483) GN=norW PE=3 SV=1 136 414 6.0E-12
sp|Q9UYU5|CDR_PYRAB Coenzyme A disulfide reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB14120 PE=3 SV=1 204 414 9.0E-12
sp|Q8Z4C4|NORW_SALTI Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella typhi GN=norW PE=3 SV=1 136 414 1.0E-11
sp|B5BEP9|NORW_SALPK Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi A (strain AKU_12601) GN=norW PE=3 SV=1 136 414 1.0E-11
sp|Q5PF36|NORW_SALPA Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=norW PE=3 SV=1 136 414 1.0E-11
sp|B4TF25|NORW_SALHS Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella heidelberg (strain SL476) GN=norW PE=3 SV=1 136 414 2.0E-11
sp|Q8D4F7|NORW_VIBVU Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio vulnificus (strain CMCP6) GN=norW PE=3 SV=1 134 421 2.0E-11
sp|B5RDG6|NORW_SALG2 Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=norW PE=3 SV=1 136 414 2.0E-11
sp|Q5E3X0|NORW_VIBF1 Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=norW PE=3 SV=2 136 414 2.0E-11
sp|B5QV90|NORW_SALEP Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella enteritidis PT4 (strain P125109) GN=norW PE=3 SV=1 136 414 3.0E-11
sp|C0PWN3|NORW_SALPC Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella paratyphi C (strain RKS4594) GN=norW PE=3 SV=1 136 414 3.0E-11
sp|Q57KT2|NORW_SALCH Nitric oxide reductase FlRd-NAD(+) reductase OS=Salmonella choleraesuis (strain SC-B67) GN=norW PE=3 SV=1 136 414 3.0E-11
sp|Q49WB0|CDR_STAS1 Coenzyme A disulfide reductase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cdr PE=3 SV=1 222 418 8.0E-11
sp|B5FG80|NORW_VIBFM Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio fischeri (strain MJ11) GN=norW PE=3 SV=1 136 414 8.0E-11
sp|Q7MFY7|NORW_VIBVY Nitric oxide reductase FlRd-NAD(+) reductase OS=Vibrio vulnificus (strain YJ016) GN=norW PE=3 SV=1 134 421 2.0E-10
sp|Q5XC60|NAOX_STRP6 Probable NADH oxidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0868 PE=1 SV=1 135 415 4.0E-10
sp|Q4L4Y7|CDR_STAHJ Coenzyme A disulfide reductase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cdr PE=3 SV=1 208 418 5.0E-10
sp|Q7A6H1|CDR_STAAN Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain N315) GN=cdr PE=1 SV=3 219 418 3.0E-09
sp|Q99VC0|CDR_STAAM Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cdr PE=3 SV=3 219 418 3.0E-09
sp|A7X0I7|CDR_STAA1 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=cdr PE=3 SV=1 219 418 3.0E-09
sp|Q8NXE8|CDR_STAAW Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MW2) GN=cdr PE=3 SV=3 219 418 5.0E-09
sp|Q6GAV6|CDR_STAAS Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MSSA476) GN=cdr PE=3 SV=3 219 418 5.0E-09
sp|P22944|NIR_EMENI Nitrite reductase [NAD(P)H] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niiA PE=3 SV=2 132 416 9.0E-09
sp|O52582|CDR_STAA8 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain NCTC 8325) GN=cdr PE=1 SV=3 219 418 1.0E-08
sp|Q6GIB7|CDR_STAAR Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain MRSA252) GN=cdr PE=3 SV=3 219 418 2.0E-08
sp|Q5HHB4|CDR_STAAC Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain COL) GN=cdr PE=3 SV=3 219 418 2.0E-08
sp|A8Z076|CDR_STAAT Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=cdr PE=3 SV=1 219 418 2.0E-08
sp|A6QFI1|CDR_STAAE Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain Newman) GN=cdr PE=3 SV=1 219 418 2.0E-08
sp|Q2FIA5|CDR_STAA3 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain USA300) GN=cdr PE=1 SV=1 219 418 2.0E-08
sp|Q2YWW1|CDR_STAAB Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cdr PE=3 SV=1 219 418 2.0E-07
sp|P11959|DLDH1_GEOSE Dihydrolipoyl dehydrogenase OS=Geobacillus stearothermophilus GN=pdhD PE=1 SV=2 216 451 3.0E-07
sp|P08201|NIRB_ECOLI Nitrite reductase (NADH) large subunit OS=Escherichia coli (strain K12) GN=nirB PE=3 SV=4 135 416 4.0E-07
sp|Q5UYG6|DLDH2_HALMA Dihydrolipoyl dehydrogenase 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=lpdA2 PE=3 SV=1 193 426 5.0E-07
sp|Q8BUE4|AIFM2_MOUSE Apoptosis-inducing factor 2 OS=Mus musculus GN=Aifm2 PE=1 SV=1 202 414 8.0E-07
sp|Q7N4V8|HCAC_PHOLL 3-phenylpropionate/cinnamic acid dioxygenase ferredoxin subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hcaC PE=3 SV=1 15 110 1.0E-06
sp|D0VWY5|GASHR_MARGR Glutathione amide reductase OS=Marichromatium gracile GN=garB PE=1 SV=1 208 413 2.0E-06
sp|Q8GI16|CARAC_PSERE Ferredoxin CarAc OS=Pseudomonas resinovorans GN=carAc PE=1 SV=1 7 110 2.0E-06
sp|Q41219|LEGRE_SOYBN Leghemoglobin reductase OS=Glycine max GN=FLBR PE=1 SV=1 176 417 3.0E-06
sp|P37061|NAOX_ENTFA NADH oxidase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=nox PE=1 SV=1 205 419 3.0E-06
sp|O58308|CDR_PYRHO Coenzyme A disulfide reductase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0572 PE=1 SV=1 168 414 3.0E-06
sp|P21880|DLDH1_BACSU Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=pdhD PE=3 SV=1 201 476 5.0E-06
sp|P31023|DLDH_PEA Dihydrolipoyl dehydrogenase, mitochondrial OS=Pisum sativum GN=LPD PE=1 SV=2 231 417 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0051537 2 iron, 2 sulfur cluster binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0005488 binding No
GO:0051540 metal cluster binding No
GO:0051536 iron-sulfur cluster binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5401
MAKEYRLKDVSSLSLGPGTKREVEVEGLDNAKVLLVNAAGKVQALGAKCTHYGAPLAKGVLTASGRLTCPWHGAC
FNATTGDVEDAPALDALPVFSVTERDGAVYITGDEAAITGSRRKPNLRCAAAAAGAQQDKVVVVGGGSGAMGVVE
GLRENGYSGPITIVSNESYLPIDRPKLSKALLTDPAKLALRDKSWFDNASIDWVEAEVNGIDFAARSVKTKQGSA
FDYTKLVIATGGTPRTLPLQGFKVLGNIFTLRSVHDAKAIVGAIGDKGKKIVIIGSSFIGMEAAVATCNGNTVTV
VDMSKTPLERVLGQQIGAGIQKIVEAKGVKFYLGAGIEKAEPAASDPSKVGAVCLKDGTRLEADLVILGVGVGPA
TEFLRDNSILRLEQDGSIKTDEKFQVAGLKDVYAIGDIATYPYHGPGGEGKPTRIEHWNVAQNAGRAAAAHIAGR
PGTGRHFIPVFWSALGAQMRYCGNPANGWDDLVLKGDPAEAKFVAYYARGETVVAMASMGMDPAMVQSAELMRRG
KMPSKSQLKEGLDIMDVGVLE*
Coding >Hirsu2|5401
ATGGCTAAAGAGTACAGACTCAAGGACGTCTCGTCCCTGTCTCTGGGCCCGGGCACAAAGCGGGAAGTCGAGGTC
GAGGGCCTCGATAATGCCAAGGTGCTCCTCGTCAACGCCGCCGGCAAAGTCCAGGCACTGGGCGCCAAGTGCACT
CACTACGGAGCTCCGCTAGCAAAGGGCGTCCTGACCGCATCGGGGCGCCTCACTTGTCCCTGGCATGGGGCTTGC
TTCAATGCCACGACGGGCGATGTCGAAGACGCCCCGGCCCTTGACGCGCTCCCCGTCTTCAGCGTCACCGAGCGT
GACGGAGCCGTCTACATAACCGGTGACGAAGCCGCCATCACCGGCTCCCGTCGCAAGCCCAACTTGAGATGCGCC
GCCGCGGCAGCAGGTGCCCAGCAGGACAAGGTGGTCGTCGTCGGCGGCGGATCCGGCGCCATGGGCGTCGTCGAG
GGCCTGCGCGAAAATGGCTACTCGGGTCCCATCACCATAGTCTCCAACGAAAGCTATCTGCCCATCGACCGGCCC
AAGCTCAGCAAGGCTCTGCTCACCGACCCGGCCAAGCTGGCCTTGCGCGACAAGAGCTGGTTCGACAACGCCTCC
ATCGACTGGGTCGAGGCTGAGGTCAATGGCATTGACTTCGCCGCCCGCTCCGTCAAGACCAAGCAGGGCAGCGCC
TTTGACTACACAAAGCTCGTCATCGCCACGGGTGGAACGCCGAGGACGCTCCCTCTGCAGGGATTCAAGGTGCTC
GGAAACATTTTTACCTTGCGGAGCGTGCACGACGCCAAGGCCATTGTCGGGGCCATCGGCGACAAGGGCAAGAAG
ATTGTCATTATCGGCTCCTCCTTCATCGGCATGGAGGCGGCTGTTGCGACGTGTAACGGCAACACCGTCACCGTC
GTGGACATGAGCAAGACGCCCCTGGAGCGCGTCCTCGGCCAGCAAATCGGCGCCGGCATCCAAAAGATTGTCGAG
GCCAAGGGTGTCAAGTTCTACCTGGGGGCCGGCATCGAAAAGGCCGAGCCCGCCGCGTCCGATCCCTCCAAGGTG
GGCGCCGTCTGCCTCAAGGACGGCACCAGGCTCGAGGCCGACCTGGTCATCCTCGGCGTCGGCGTCGGTCCCGCC
ACTGAGTTTCTGCGGGACAACAGCATCTTGCGCCTGGAGCAGGACGGTTCCATCAAGACGGACGAGAAGTTCCAG
GTGGCCGGGCTCAAGGACGTGTATGCCATCGGCGACATCGCCACCTACCCCTACCACGGGCCGGGCGGCGAGGGC
AAGCCCACGCGCATTGAGCACTGGAACGTGGCCCAAAACGCGGGCCGCGCCGCCGCGGCCCACATCGCCGGCCGC
CCGGGCACCGGCCGGCACTTCATCCCCGTCTTCTGGTCCGCCCTGGGCGCGCAGATGCGCTACTGCGGCAACCCG
GCCAACGGCTGGGACGACCTGGTGCTCAAGGGCGACCCGGCCGAGGCCAAGTTCGTCGCCTACTACGCGAGGGGC
GAGACGGTAGTGGCCATGGCCAGCATGGGCATGGACCCGGCCATGGTGCAGAGCGCGGAGCTGATGAGGCGAGGC
AAGATGCCCAGCAAGAGCCAGCTGAAGGAGGGGCTGGACATTATGGACGTCGGCGTGCTGGAGTGA
Transcript >Hirsu2|5401
ATGGCTAAAGAGTACAGACTCAAGGACGTCTCGTCCCTGTCTCTGGGCCCGGGCACAAAGCGGGAAGTCGAGGTC
GAGGGCCTCGATAATGCCAAGGTGCTCCTCGTCAACGCCGCCGGCAAAGTCCAGGCACTGGGCGCCAAGTGCACT
CACTACGGAGCTCCGCTAGCAAAGGGCGTCCTGACCGCATCGGGGCGCCTCACTTGTCCCTGGCATGGGGCTTGC
TTCAATGCCACGACGGGCGATGTCGAAGACGCCCCGGCCCTTGACGCGCTCCCCGTCTTCAGCGTCACCGAGCGT
GACGGAGCCGTCTACATAACCGGTGACGAAGCCGCCATCACCGGCTCCCGTCGCAAGCCCAACTTGAGATGCGCC
GCCGCGGCAGCAGGTGCCCAGCAGGACAAGGTGGTCGTCGTCGGCGGCGGATCCGGCGCCATGGGCGTCGTCGAG
GGCCTGCGCGAAAATGGCTACTCGGGTCCCATCACCATAGTCTCCAACGAAAGCTATCTGCCCATCGACCGGCCC
AAGCTCAGCAAGGCTCTGCTCACCGACCCGGCCAAGCTGGCCTTGCGCGACAAGAGCTGGTTCGACAACGCCTCC
ATCGACTGGGTCGAGGCTGAGGTCAATGGCATTGACTTCGCCGCCCGCTCCGTCAAGACCAAGCAGGGCAGCGCC
TTTGACTACACAAAGCTCGTCATCGCCACGGGTGGAACGCCGAGGACGCTCCCTCTGCAGGGATTCAAGGTGCTC
GGAAACATTTTTACCTTGCGGAGCGTGCACGACGCCAAGGCCATTGTCGGGGCCATCGGCGACAAGGGCAAGAAG
ATTGTCATTATCGGCTCCTCCTTCATCGGCATGGAGGCGGCTGTTGCGACGTGTAACGGCAACACCGTCACCGTC
GTGGACATGAGCAAGACGCCCCTGGAGCGCGTCCTCGGCCAGCAAATCGGCGCCGGCATCCAAAAGATTGTCGAG
GCCAAGGGTGTCAAGTTCTACCTGGGGGCCGGCATCGAAAAGGCCGAGCCCGCCGCGTCCGATCCCTCCAAGGTG
GGCGCCGTCTGCCTCAAGGACGGCACCAGGCTCGAGGCCGACCTGGTCATCCTCGGCGTCGGCGTCGGTCCCGCC
ACTGAGTTTCTGCGGGACAACAGCATCTTGCGCCTGGAGCAGGACGGTTCCATCAAGACGGACGAGAAGTTCCAG
GTGGCCGGGCTCAAGGACGTGTATGCCATCGGCGACATCGCCACCTACCCCTACCACGGGCCGGGCGGCGAGGGC
AAGCCCACGCGCATTGAGCACTGGAACGTGGCCCAAAACGCGGGCCGCGCCGCCGCGGCCCACATCGCCGGCCGC
CCGGGCACCGGCCGGCACTTCATCCCCGTCTTCTGGTCCGCCCTGGGCGCGCAGATGCGCTACTGCGGCAACCCG
GCCAACGGCTGGGACGACCTGGTGCTCAAGGGCGACCCGGCCGAGGCCAAGTTCGTCGCCTACTACGCGAGGGGC
GAGACGGTAGTGGCCATGGCCAGCATGGGCATGGACCCGGCCATGGTGCAGAGCGCGGAGCTGATGAGGCGAGGC
AAGATGCCCAGCAAGAGCCAGCTGAAGGAGGGGCTGGACATTATGGACGTCGGCGTGCTGGAGTGA
Gene >Hirsu2|5401
ATGGCTAAAGAGTACAGACTCAAGGACGTCTCGTCCCTGTCTCTGGGCCCGGGCACAAAGCGGGAAGTCGAGGTC
GAGGGCCTCGATAATGCCAAGGTGCTCCTCGTCAACGCCGCCGGCAAAGTCCAGGCACTGGGCGCCAAGTGCACT
CACTACGGAGCTCCGCTAGCAAAGGGCGTCCTGACCGCATCGGGGCGCCTCACTTGTCCCTGGCATGGGGGTAAG
GCTTCCTCTCTTCCTCTTCCCCCTGACCAAGCCGTGTCCCTCCTTCTGCCTCGCATCAGCGCCCGCTCGACGGAA
CCGAGACGGCTGACCGGCCCGGTTAGCTTGCTTCAATGCCACGACGGGCGATGTCGAAGACGCCCCGGCCCTTGA
CGCGCTCCCCGTCTTCAGCGTCACCGAGCGTGACGGAGCCGTCTACATAACCGGTGACGAAGCCGCCATCACCGG
CTCCCGTCGCAAGCCCAACTTGAGATGCGCCGCCGCGGCAGCAGGTGCCCAGCAGGACAAGGTGGTCGTCGTCGG
CGGCGGATCCGGCGCCATGGGCGTCGTCGAGGGCCTGCGCGAAAATGGCTACTCGGGTCCCATCACCATAGTCTC
CAACGAAAGCTATCTGCCCATCGACCGGCCCAAGCTCAGCAAGGCTCTGCTCACCGACCCGGCCAAGCTGGCCTT
GCGCGACAAGAGCTGGTTCGACAACGCCTCCATCGACTGGGTCGAGGCTGAGGTCAATGGCATTGACTTCGCCGC
CCGCTCCGTCAAGACCAAGCAGGGCAGCGCCTTTGACTACACAAAGCTCGTCATCGCCACGGGTGGAACGCCGAG
GACGCTCCCTCTGCAGGGATTCAAGGTGCTCGGAAACATTTTTACCTTGCGGAGCGTGCACGACGCCAAGGCCAT
TGTCGGGGCCATCGGCGACAAGGGCAAGAAGATTGTCATTATCGGCTCCTCCTTCATCGGCATGGAGGCGGCTGT
TGCGACGTGTAACGGCAACACCGTCACCGTCGTGGACATGAGCAAGACGCCCCTGGAGCGCGTCCTCGGCCAGCA
AATCGGCGCCGGCATCCAAAAGATTGTCGAGGCCAAGGGTGTCAAGTTCTACCTGGGGGCCGGCATCGAAAAGGC
CGAGCCCGCCGCGTCCGATCCCTCCAAGGTGGGCGCCGTCTGCCTCAAGGACGGCACCAGGCTCGAGGCCGACCT
GGTCATCCTCGGCGTCGGCGTCGGTCCCGCCACTGAGTTTCTGCGGGACAACAGCATCTTGCGCCTGGAGCAGGA
CGGTTCCATCAAGACGGACGAGAAGTTCCAGGTGGCCGGGCTCAAGGACGTGTATGCCATCGGCGACATCGCCAC
CTACCCCTACCACGGGCCGGGCGGCGAGGGCAAGCCCACGCGCATTGAGCACTGGAACGTGGCCCAAAACGCGGG
CCGCGCCGCCGCGGCCCACATCGCCGGCCGCCCGGGCACCGGCCGGCACTTCATCCCCGTCTTCTGGTCCGCCCT
GGGCGCGCAGATGCGCTACTGCGGCAACCCGGCCAACGGCTGGGACGACCTGGTGCTCAAGGGCGACCCGGCCGA
GGCCAAGTTCGTCGCCTACTACGCGAGGGGCGAGACGGTAGTGGCCATGGCCAGCATGGGCATGGACCCGGCCAT
GGTGCAGAGCGCGGAGCTGATGAGGCGAGGCAAGATGCCCAGCAAGAGCCAGCTGAAGGAGGGGCTGGACATTAT
GGACGTCGGCGTGCTGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail