Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|54
Gene name
LocationContig_1004:6446..9343
Strand+
Gene length (bp)2897
Transcript length (bp)2691
Coding sequence length (bp)2691
Protein length (aa) 897

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08590 DUF1771 Domain of unknown function (DUF1771) 1.8E-14 694 757
PF01713 Smr Smr domain 5.6E-07 769 824

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O64843|CID7_ARATH Polyadenylate-binding protein-interacting protein 7 OS=Arabidopsis thaliana GN=CID7 PE=1 SV=1 672 824 4.0E-18
sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2 694 836 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|54
LPNPVPGLACAAAKFQAARLRSVVCDPAVRDPSKRFHQLRISTAGHLRRHASFFRPLVVCLVVCPLPAARLASPP
RPLRGLAVLDGFSLGRVVRRRPSLVAFAFASLRRQRRPLHAQRRPDWSPLRFRSTWARRRNVIRPSSALDACYTD
HRLVRLPAAKREPSNMVSDEHYELCLPILQDPSLEDEDKTDRLEDLLKKETSLTGPSLDNVVLDAMWRYREAGGV
SASPPPIRQSILRRPSPASWRGSSTPVTGSPRLGVSPLAPPGFVPATFSRTKSSTASPFSSPRASPRLALATPAI
PHSPNLNAYEFASDPTPATEILGDYQTENVEWLVNDDAVSVSSSVGTSSGLNAAAPEFSSMSSQQADMSPYDMLR
SILGQTRTDEEIEAALALHGYDLSATIAAIMESQVSDGALLNAPMDEPRGVMIGKSISPDGRPSTPASQQKTGVI
CKFYMSTGQCLRADCRFSHDLSSHICKYWVMGNCLAGETCIFSHDPSKLVNKLSMEENGAAPAKNYGSPQLQDTN
SFPFLQQENAGHKGGPAVDGAAAAAAANLTPPMGPRHLHGTESPRLRSRPGSRQQTKDMTSAPALDDNEAFPSLG
SASMKQGKKHHGKRGGHGHSHKENLVPSSLADIVKRTPSPAPGSSRPESRKSCQNGGGAVVPLRNGENSAASQAI
PSPKNIPWLETGDRANKAYLKARQEAIKHGGLRNKFLQSAAQAWNRNDARAAKALSLRGQSENDLMRKAHREAAR
ELYEQRNKGGMGSGSETYVDLHGLHPEEAVDYLEKVLTENGKQARPVYAITGTGHHSKNGKDKVGKAIRNFLNEW
RYAYREFSVPGDRNSMGGILGIDARSRDKSRAREREDSKNEVDILSQGVEIGDGKVRLLVRDPPKGPSSRR*
Coding >Hirsu2|54
CTGCCTAATCCGGTGCCGGGGCTCGCGTGCGCAGCGGCCAAGTTTCAGGCCGCCCGGCTGCGATCCGTCGTCTGC
GATCCCGCCGTCCGCGATCCGTCGAAGCGCTTCCACCAGCTGCGCATCTCTACCGCCGGGCATCTGCGACGCCAT
GCGAGCTTCTTCCGTCCGCTCGTCGTCTGCCTCGTCGTCTGCCCGCTGCCCGCTGCCCGCCTCGCCTCGCCCCCT
CGCCCTCTTCGTGGCCTGGCCGTCCTCGACGGCTTCTCATTGGGCCGAGTCGTGAGACGTAGACCTTCGCTTGTT
GCTTTCGCCTTCGCCTCCCTCCGCCGCCAGCGTCGGCCGCTTCACGCACAGAGGCGTCCCGACTGGTCTCCGCTC
CGCTTCCGCTCGACTTGGGCAAGGCGGAGAAACGTGATCCGCCCGAGCTCGGCGCTCGACGCCTGCTACACCGAC
CATCGTCTTGTCCGCCTCCCTGCCGCCAAACGCGAGCCGTCCAACATGGTGTCGGACGAGCACTACGAGCTGTGC
CTGCCCATCCTGCAGGACCCCTCCCTCGAAGACGAAGACAAGACCGACAGGCTCGAGGACCTCCTCAAGAAGGAG
ACAAGCCTGACGGGACCCTCCCTCGATAATGTCGTCCTCGACGCCATGTGGAGATACCGCGAAGCCGGAGGGGTG
TCGGCATCGCCTCCGCCCATCCGCCAGTCCATCCTGCGCCGCCCTTCGCCGGCCTCGTGGCGCGGATCATCGACG
CCCGTGACGGGATCCCCGCGGCTGGGCGTCAGTCCGCTGGCACCGCCCGGCTTCGTCCCGGCCACCTTCAGCCGG
ACCAAGTCGTCGACGGCCTCGCCCTTTTCCTCGCCGCGCGCCTCGCCGCGCCTCGCCCTGGCCACGCCGGCCATC
CCCCACAGCCCGAACCTCAACGCCTACGAGTTCGCGAGCGACCCGACGCCCGCCACCGAAATCCTGGGCGACTAC
CAGACGGAGAACGTCGAGTGGCTGGTCAACGACGACGCCGTCAGCGTCTCCTCGTCCGTCGGCACCTCGAGCGGG
CTCAACGCCGCCGCGCCCGAATTCTCCTCCATGTCCTCCCAGCAGGCCGACATGTCGCCGTACGACATGCTGCGC
TCGATTCTCGGACAGACGCGGACCGACGAGGAGATTGAAGCCGCGCTGGCCCTGCACGGCTACGACCTGAGCGCC
ACCATCGCGGCCATCATGGAGAGCCAGGTTTCGGACGGGGCCCTCTTGAACGCGCCCATGGACGAGCCCAGGGGC
GTCATGATCGGCAAGTCCATCTCCCCCGACGGACGCCCGTCCACGCCGGCCAGCCAGCAGAAGACGGGCGTCATC
TGCAAGTTCTACATGTCGACGGGGCAGTGTCTCCGTGCCGACTGCCGCTTCAGCCACGACCTGAGCAGCCACATC
TGCAAGTACTGGGTCATGGGGAATTGCCTTGCCGGCGAGACGTGCATCTTTTCGCACGACCCGTCCAAGCTGGTG
AACAAGCTGTCGATGGAGGAGAACGGGGCCGCTCCGGCCAAGAACTATGGCAGCCCCCAGCTGCAGGACACGAAC
TCGTTCCCGTTTCTCCAGCAAGAAAACGCGGGACACAAGGGCGGCCCTGCCGTCGACGGGGCCGCCGCCGCCGCC
GCCGCCAACCTCACGCCCCCGATGGGGCCTCGCCACCTGCACGGCACGGAGAGTCCACGACTGAGATCGCGGCCC
GGCAGCCGGCAGCAAACCAAGGACATGACGTCGGCCCCGGCCTTGGACGACAACGAGGCATTTCCGTCGCTCGGC
TCGGCATCGATGAAGCAGGGCAAGAAGCACCACGGTAAGCGCGGGGGACACGGCCACAGCCACAAGGAGAACCTG
GTGCCCAGCTCGTTGGCAGACATTGTCAAGAGGACGCCGTCGCCGGCGCCCGGGTCGTCGCGGCCCGAATCGAGG
AAGTCGTGCCAAAACGGAGGTGGAGCGGTGGTGCCGCTGCGCAACGGCGAGAACAGCGCGGCGTCGCAGGCGATC
CCCAGCCCCAAGAACATACCCTGGCTGGAGACGGGCGACCGGGCGAACAAGGCGTATCTGAAGGCCCGCCAGGAG
GCTATCAAGCACGGCGGGCTCCGGAACAAGTTCCTGCAGAGTGCGGCGCAAGCGTGGAACCGCAACGACGCGAGG
GCGGCCAAGGCGCTGAGCCTGCGAGGCCAGAGCGAGAACGACCTGATGCGAAAGGCGCACCGCGAGGCGGCGCGC
GAGCTGTACGAGCAGCGGAACAAGGGCGGCATGGGCAGCGGGTCGGAGACATACGTGGACCTCCACGGCCTCCAC
CCGGAGGAGGCGGTCGACTACCTGGAGAAGGTGCTGACGGAGAACGGCAAACAGGCGCGGCCGGTGTACGCCATC
ACGGGCACGGGGCACCACAGCAAGAACGGCAAGGACAAGGTGGGCAAGGCGATCCGCAACTTTCTCAACGAGTGG
CGGTACGCCTACCGCGAGTTCTCGGTGCCCGGGGACCGCAACAGCATGGGCGGCATCCTGGGCATCGACGCGCGC
AGCCGGGACAAGTCGCGGGCGCGGGAGCGCGAGGACAGCAAGAACGAGGTCGACATTCTCAGCCAGGGCGTCGAG
ATCGGGGACGGCAAGGTGCGGCTGCTGGTGCGCGACCCGCCCAAGGGGCCGAGCAGCCGCCGATGA
Transcript >Hirsu2|54
CTGCCTAATCCGGTGCCGGGGCTCGCGTGCGCAGCGGCCAAGTTTCAGGCCGCCCGGCTGCGATCCGTCGTCTGC
GATCCCGCCGTCCGCGATCCGTCGAAGCGCTTCCACCAGCTGCGCATCTCTACCGCCGGGCATCTGCGACGCCAT
GCGAGCTTCTTCCGTCCGCTCGTCGTCTGCCTCGTCGTCTGCCCGCTGCCCGCTGCCCGCCTCGCCTCGCCCCCT
CGCCCTCTTCGTGGCCTGGCCGTCCTCGACGGCTTCTCATTGGGCCGAGTCGTGAGACGTAGACCTTCGCTTGTT
GCTTTCGCCTTCGCCTCCCTCCGCCGCCAGCGTCGGCCGCTTCACGCACAGAGGCGTCCCGACTGGTCTCCGCTC
CGCTTCCGCTCGACTTGGGCAAGGCGGAGAAACGTGATCCGCCCGAGCTCGGCGCTCGACGCCTGCTACACCGAC
CATCGTCTTGTCCGCCTCCCTGCCGCCAAACGCGAGCCGTCCAACATGGTGTCGGACGAGCACTACGAGCTGTGC
CTGCCCATCCTGCAGGACCCCTCCCTCGAAGACGAAGACAAGACCGACAGGCTCGAGGACCTCCTCAAGAAGGAG
ACAAGCCTGACGGGACCCTCCCTCGATAATGTCGTCCTCGACGCCATGTGGAGATACCGCGAAGCCGGAGGGGTG
TCGGCATCGCCTCCGCCCATCCGCCAGTCCATCCTGCGCCGCCCTTCGCCGGCCTCGTGGCGCGGATCATCGACG
CCCGTGACGGGATCCCCGCGGCTGGGCGTCAGTCCGCTGGCACCGCCCGGCTTCGTCCCGGCCACCTTCAGCCGG
ACCAAGTCGTCGACGGCCTCGCCCTTTTCCTCGCCGCGCGCCTCGCCGCGCCTCGCCCTGGCCACGCCGGCCATC
CCCCACAGCCCGAACCTCAACGCCTACGAGTTCGCGAGCGACCCGACGCCCGCCACCGAAATCCTGGGCGACTAC
CAGACGGAGAACGTCGAGTGGCTGGTCAACGACGACGCCGTCAGCGTCTCCTCGTCCGTCGGCACCTCGAGCGGG
CTCAACGCCGCCGCGCCCGAATTCTCCTCCATGTCCTCCCAGCAGGCCGACATGTCGCCGTACGACATGCTGCGC
TCGATTCTCGGACAGACGCGGACCGACGAGGAGATTGAAGCCGCGCTGGCCCTGCACGGCTACGACCTGAGCGCC
ACCATCGCGGCCATCATGGAGAGCCAGGTTTCGGACGGGGCCCTCTTGAACGCGCCCATGGACGAGCCCAGGGGC
GTCATGATCGGCAAGTCCATCTCCCCCGACGGACGCCCGTCCACGCCGGCCAGCCAGCAGAAGACGGGCGTCATC
TGCAAGTTCTACATGTCGACGGGGCAGTGTCTCCGTGCCGACTGCCGCTTCAGCCACGACCTGAGCAGCCACATC
TGCAAGTACTGGGTCATGGGGAATTGCCTTGCCGGCGAGACGTGCATCTTTTCGCACGACCCGTCCAAGCTGGTG
AACAAGCTGTCGATGGAGGAGAACGGGGCCGCTCCGGCCAAGAACTATGGCAGCCCCCAGCTGCAGGACACGAAC
TCGTTCCCGTTTCTCCAGCAAGAAAACGCGGGACACAAGGGCGGCCCTGCCGTCGACGGGGCCGCCGCCGCCGCC
GCCGCCAACCTCACGCCCCCGATGGGGCCTCGCCACCTGCACGGCACGGAGAGTCCACGACTGAGATCGCGGCCC
GGCAGCCGGCAGCAAACCAAGGACATGACGTCGGCCCCGGCCTTGGACGACAACGAGGCATTTCCGTCGCTCGGC
TCGGCATCGATGAAGCAGGGCAAGAAGCACCACGGTAAGCGCGGGGGACACGGCCACAGCCACAAGGAGAACCTG
GTGCCCAGCTCGTTGGCAGACATTGTCAAGAGGACGCCGTCGCCGGCGCCCGGGTCGTCGCGGCCCGAATCGAGG
AAGTCGTGCCAAAACGGAGGTGGAGCGGTGGTGCCGCTGCGCAACGGCGAGAACAGCGCGGCGTCGCAGGCGATC
CCCAGCCCCAAGAACATACCCTGGCTGGAGACGGGCGACCGGGCGAACAAGGCGTATCTGAAGGCCCGCCAGGAG
GCTATCAAGCACGGCGGGCTCCGGAACAAGTTCCTGCAGAGTGCGGCGCAAGCGTGGAACCGCAACGACGCGAGG
GCGGCCAAGGCGCTGAGCCTGCGAGGCCAGAGCGAGAACGACCTGATGCGAAAGGCGCACCGCGAGGCGGCGCGC
GAGCTGTACGAGCAGCGGAACAAGGGCGGCATGGGCAGCGGGTCGGAGACATACGTGGACCTCCACGGCCTCCAC
CCGGAGGAGGCGGTCGACTACCTGGAGAAGGTGCTGACGGAGAACGGCAAACAGGCGCGGCCGGTGTACGCCATC
ACGGGCACGGGGCACCACAGCAAGAACGGCAAGGACAAGGTGGGCAAGGCGATCCGCAACTTTCTCAACGAGTGG
CGGTACGCCTACCGCGAGTTCTCGGTGCCCGGGGACCGCAACAGCATGGGCGGCATCCTGGGCATCGACGCGCGC
AGCCGGGACAAGTCGCGGGCGCGGGAGCGCGAGGACAGCAAGAACGAGGTCGACATTCTCAGCCAGGGCGTCGAG
ATCGGGGACGGCAAGGTGCGGCTGCTGGTGCGCGACCCGCCCAAGGGGCCGAGCAGCCGCCGATGA
Gene >Hirsu2|54
CTGCCTAATCCGGTGCCGGGGCTCGCGTGCGCAGCGGCCAAGTTTCAGGCCGCCCGGCTGCGATCCGTCGTCTGC
GATCCCGCCGTCCGCGATCCGTCGAAGCGCTTCCACCAGCTGCGCATCTCTACCGCCGGGCATCTGCGACGCCAT
GCGAGCTTCTTCCGTCCGCTCGTCGTCTGCCTCGTCGTCTGCCCGCTGCCCGCTGCCCGCCTCGCCTCGCCCCCT
CGCCCTCTTCGTGGCCTGGCCGTCCTCGACGGCTTCTCATTGGGCCGAGTCGTGAGACGTAGACGTGAGCTCGCG
GATGCCGCCGCCTCGTCGTCCCCTGAGATGCGCCAAGGCTTACTTACGAGACGCCATCAGCTTCGCTTGTTGCTT
TCGCCTTCGCCTCCCTCCGCCGCCAGCGTCGGCCGCTTCACGCACAGAGGCGTCCCGACTGGTCTCCGCTCCGCT
TCCGCTCGACTTGGGCAAGGCGGAGAAACGTGATCCGCCCGAGCTCGGCGCTCGACGCCTGCTACACCGACCATC
GTCTTGTCCGCCTCCCTGCCGCCAAACGCGAGCCGTCCAACATGGTGTCGGACGAGCACTACGAGCTGTGCCTGC
CCATCCTGCAGGACCCCTCCCTCGAAGACGAAGACAAGACCGACAGGCTCGAGGACCTCCTCAAGAAGGAGACAA
GCCTGACGGGACCCTCCCTCGATAATGTCGTCCTCGACGCCATGTGGAGATACCGCGAAGCCGGAGGGGTGTCGG
CATCGCCTCCGCCCATCCGCCAGTCCATCCTGCGCCGCCCTTCGCCGGCCTCGTGGCGCGGATCATCGACGCCCG
TGACGGGATCCCCGCGGCTGGGCGTCAGTCCGCTGGCACCGCCCGGCTTCGTCCCGGCCACCTTCAGCCGGACCA
AGTCGTCGACGGCCTCGCCCTTTTCCTCGCCGCGCGCCTCGCCGCGCCTCGCCCTGGCCACGCCGGCCATCCCCC
ACAGCCCGAACCTCAACGCCTACGAGTTCGCGAGCGACCCGACGCCCGCCACCGAAATCCTGGGCGACTACCAGA
CGGAGAACGTCGAGTGGCTGGTCAACGACGACGCCGTCAGCGTCTCCTCGTCCGTCGGCACCTCGAGCGGGCTCA
ACGCCGCCGCGCCCGAATTCTCCTCCATGTCCTCCCAGCAGGCCGACATGTCGCCGTACGACATGCTGCGCTCGA
TTCTCGGACAGACGCGGACCGACGAGGAGATTGAAGCCGCGCTGGCCCTGCACGGCTACGACCTGAGCGCCACCA
TCGCGGCCATCATGGAGAGCCAGGTTTCGGACGGGGCCCTCTTGAACGCGCCCATGGACGAGCCCAGGGGCGTCA
TGATCGGCAAGTCCATCTCCCCCGACGGACGCCCGTCCACGCCGGCCAGCCAGCAGAAGACGGGCGTCATCTGCA
AGTTCTACATGTCGACGGGGCAGTGTCTCCGTGCCGACTGCCGCTTCAGCCACGACCTGAGCAGCCACATCTGCA
AGTAAGCCTCGCTCGTGATCCCGACTCATGACAGAATGGTTCCCCCGGCTCATCTGAGACAGGTACTGGGTCATG
GGGAATTGCCTTGCCGGCGAGACGTGCATCTTTTCGCACGACCCGTCCAAGCTGGTGAACAAGCTGTCGATGGAG
GAGAACGGGGCCGCTCCGGCCAAGAACTATGGCAGCCCCCAGCTGCAGGACACGAACTCGTTCCCGTTTCTCCAG
CAAGAAAACGCGGGACACAAGGGCGGCCCTGCCGTCGACGGGGCCGCCGCCGCCGCCGCCGCCAACCTCACGCCC
CCGATGGGGCCTCGCCACCTGCACGGCACGGAGAGTCCACGACTGAGATCGCGGCCCGGCAGCCGGCAGCAAACC
AAGGACATGACGTCGGCCCCGGCCTTGGACGACAACGAGGCATTTCCGTCGCTCGGCTCGGCATCGATGAAGCAG
GGCAAGAAGCACCACGGTAAGCGCGGGGGACACGGCCACAGCCACAAGGAGAACCTGGTGCCCAGCTCGTTGGCA
GACATTGTCAAGAGGACGCCGTCGCCGGCGCCCGGGTCGTCGCGGCCCGAATCGAGGAAGTCGTGCCAAAACGGA
GGTGGAGCGGTGGTGCCGCTGCGCAACGGCGAGAACAGCGCGGCGTCGCAGGCGATCCCCAGCCCCAAGAACATA
CCCTGGCTGGAGACGGGCGACCGGGCGAACAAGGCGTATCTGAAGGCCCGCCAGGAGGCTATCAAGCACGGCGGG
CTCCGGAACAAGTTCCTGCAGAGGTACGTCGGCTGCGGCCAGCCATGCTCACCCACCCACACCCGACACGGCCGG
GGGCTAAAGCGGGAGGCGGCAGTGCGGCGCAAGCGTGGAACCGCAACGACGCGAGGGCGGCCAAGGCGCTGAGCC
TGCGAGGCCAGAGCGAGAACGACCTGATGCGAAAGGCGCACCGCGAGGCGGCGCGCGAGCTGTACGAGCAGCGGA
ACAAGGGCGGCATGGGCAGCGGGTCGGAGACATACGTGGACCTCCACGGCCTCCACCCGGAGGAGGCGGTCGACT
ACCTGGAGAAGGTGCTGACGGAGAACGGCAAACAGGCGCGGCCGGTGTACGCCATCACGGGCACGGGGCACCACA
GCAAGAACGGCAAGGACAAGGTGGGCAAGGCGATCCGCAACTTTCTCAACGAGTGGCGGTACGCCTACCGCGAGT
TCTCGGTGCCCGGGGACCGCAACAGCATGGGCGGCATCCTGGGCATCGACGCGCGCAGCCGGGACAAGTCGCGGG
CGCGGGAGCGCGAGGACAGCAAGAACGAGGTCGACATTCTCAGCCAGGGCGTCGAGATCGGGGACGGCAAGGTGC
GGCTGCTGGTGCGCGACCCGCCCAAGGGGCCGAGCAGCCGCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail