Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5397
Gene name
LocationContig_27:41685..44231
Strand-
Gene length (bp)2546
Transcript length (bp)2322
Coding sequence length (bp)2322
Protein length (aa) 774

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 1.6E-40 303 770
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 3.6E-20 176 248
PF17807 zf-UBP_var Variant UBP zinc finger 2.3E-22 16 78
PF00627 UBA UBA/TS-N domain 1.4E-08 586 622
PF00627 UBA UBA/TS-N domain 2.5E-06 651 685
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 2.4E-12 410 752

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q11119|UBP14_SCHPO Ubiquitin carboxyl-terminal hydrolase 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp14 PE=1 SV=2 1 772 0.0E+00
sp|P56399|UBP5_MOUSE Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus GN=Usp5 PE=1 SV=1 16 773 9.0E-146
sp|P45974|UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens GN=USP5 PE=1 SV=2 16 773 7.0E-145
sp|Q5R407|UBP5_PONAB Ubiquitin carboxyl-terminal hydrolase 5 OS=Pongo abelii GN=UBP5 PE=2 SV=1 16 773 3.0E-143
sp|Q8L6Y1|UBP14_ARATH Ubiquitin carboxyl-terminal hydrolase 14 OS=Arabidopsis thaliana GN=UBP14 PE=1 SV=1 16 772 4.0E-140
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q11119|UBP14_SCHPO Ubiquitin carboxyl-terminal hydrolase 14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp14 PE=1 SV=2 1 772 0.0E+00
sp|P56399|UBP5_MOUSE Ubiquitin carboxyl-terminal hydrolase 5 OS=Mus musculus GN=Usp5 PE=1 SV=1 16 773 9.0E-146
sp|P45974|UBP5_HUMAN Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens GN=USP5 PE=1 SV=2 16 773 7.0E-145
sp|Q5R407|UBP5_PONAB Ubiquitin carboxyl-terminal hydrolase 5 OS=Pongo abelii GN=UBP5 PE=2 SV=1 16 773 3.0E-143
sp|Q8L6Y1|UBP14_ARATH Ubiquitin carboxyl-terminal hydrolase 14 OS=Arabidopsis thaliana GN=UBP14 PE=1 SV=1 16 772 4.0E-140
sp|P54201|UBPA_DICDI Ubiquitin carboxyl-terminal hydrolase A OS=Dictyostelium discoideum GN=ubpA PE=2 SV=2 12 772 3.0E-128
sp|P38237|UBP14_YEAST Ubiquitin carboxyl-terminal hydrolase 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP14 PE=1 SV=2 21 772 3.0E-124
sp|E1BMF7|UBP13_BOVIN Ubiquitin carboxyl-terminal hydrolase 13 OS=Bos taurus GN=USP13 PE=3 SV=2 16 772 8.0E-122
sp|Q92995|UBP13_HUMAN Ubiquitin carboxyl-terminal hydrolase 13 OS=Homo sapiens GN=USP13 PE=1 SV=2 16 772 2.0E-121
sp|Q5BKP2|UBP13_MOUSE Ubiquitin carboxyl-terminal hydrolase 13 OS=Mus musculus GN=Usp13 PE=1 SV=1 16 772 2.0E-121
sp|F1QFS9|UBP13_DANRE Ubiquitin carboxyl-terminal hydrolase 13 OS=Danio rerio GN=usp13 PE=2 SV=1 16 772 1.0E-119
sp|E1BY77|UBP13_CHICK Ubiquitin carboxyl-terminal hydrolase 13 OS=Gallus gallus GN=USP13 PE=3 SV=1 16 773 3.0E-118
sp|F6V6I0|UBP13_XENTR Ubiquitin carboxyl-terminal hydrolase 13 OS=Xenopus tropicalis GN=usp13 PE=3 SV=2 16 772 5.0E-96
sp|Q8R5K2|UBP33_MOUSE Ubiquitin carboxyl-terminal hydrolase 33 OS=Mus musculus GN=Usp33 PE=1 SV=2 154 418 2.0E-14
sp|Q8TEY7|UBP33_HUMAN Ubiquitin carboxyl-terminal hydrolase 33 OS=Homo sapiens GN=USP33 PE=1 SV=2 154 418 4.0E-13
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 176 561 5.0E-13
sp|Q5REG5|UBP33_PONAB Ubiquitin carboxyl-terminal hydrolase 33 OS=Pongo abelii GN=USP33 PE=2 SV=1 154 418 6.0E-13
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 176 561 1.0E-12
sp|A6QNM7|UBP33_BOVIN Ubiquitin carboxyl-terminal hydrolase 33 OS=Bos taurus GN=USP33 PE=2 SV=1 154 418 2.0E-12
sp|Q09738|UBP8_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp8 PE=3 SV=1 176 551 9.0E-12
sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens GN=USP22 PE=1 SV=2 143 574 6.0E-11
sp|A6H8I0|UBP22_DANRE Ubiquitin carboxyl-terminal hydrolase 22 OS=Danio rerio GN=usp22 PE=2 SV=1 143 556 1.0E-10
sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus GN=Usp22 PE=2 SV=2 143 556 2.0E-10
sp|Q80U87|UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus GN=Usp8 PE=1 SV=2 292 561 2.0E-10
sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens GN=USP8 PE=1 SV=1 292 561 2.0E-10
sp|A5PMR2|UBP33_DANRE Ubiquitin carboxyl-terminal hydrolase 33 OS=Danio rerio GN=usp33 PE=2 SV=1 154 415 8.0E-10
sp|Q70EK9|UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens GN=USP51 PE=2 SV=1 176 602 1.0E-09
sp|Q922Y1|UBXN1_MOUSE UBX domain-containing protein 1 OS=Mus musculus GN=Ubxn1 PE=1 SV=1 586 636 3.0E-09
sp|Q499N6|UBXN1_RAT UBX domain-containing protein 1 OS=Rattus norvegicus GN=Ubxn1 PE=3 SV=2 586 636 4.0E-09
sp|Q8C6M1|UBP20_MOUSE Ubiquitin carboxyl-terminal hydrolase 20 OS=Mus musculus GN=Usp20 PE=1 SV=1 174 430 5.0E-09
sp|Q04323|UBXN1_HUMAN UBX domain-containing protein 1 OS=Homo sapiens GN=UBXN1 PE=1 SV=2 586 636 5.0E-09
sp|Q99LG0|UBP16_MOUSE Ubiquitin carboxyl-terminal hydrolase 16 OS=Mus musculus GN=Usp16 PE=1 SV=2 184 423 1.0E-08
sp|Q32KW2|UBXN1_BOVIN UBX domain-containing protein 1 OS=Bos taurus GN=UBXN1 PE=2 SV=1 586 635 2.0E-08
sp|Q2KJ09|UBP16_RAT Ubiquitin carboxyl-terminal hydrolase 16 OS=Rattus norvegicus GN=Usp16 PE=1 SV=2 184 423 2.0E-08
sp|Q0VA64|UBP16_XENTR Ubiquitin carboxyl-terminal hydrolase 16 OS=Xenopus tropicalis GN=usp16 PE=2 SV=2 185 415 3.0E-08
sp|Q28CN3|UBP33_XENTR Ubiquitin carboxyl-terminal hydrolase 33 OS=Xenopus tropicalis GN=usp33 PE=2 SV=2 154 418 3.0E-08
sp|D2HBJ8|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1 151 249 6.0E-08
sp|P35123|UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus GN=Usp4 PE=1 SV=3 296 415 9.0E-08
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 151 249 1.0E-07
sp|Q4R6D3|UBP50_MACFA Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Macaca fascicularis GN=USP50 PE=2 SV=1 301 536 2.0E-07
sp|B2GUZ1|UBP4_RAT Ubiquitin carboxyl-terminal hydrolase 4 OS=Rattus norvegicus GN=Usp4 PE=1 SV=1 296 415 2.0E-07
sp|Q5R5Z6|UBP20_PONAB Ubiquitin carboxyl-terminal hydrolase 20 OS=Pongo abelii GN=USP20 PE=2 SV=1 154 441 2.0E-07
sp|Q9Y2K6|UBP20_HUMAN Ubiquitin carboxyl-terminal hydrolase 20 OS=Homo sapiens GN=USP20 PE=1 SV=2 174 441 2.0E-07
sp|F6Z5C0|UBP15_XENTR Ubiquitin carboxyl-terminal hydrolase 15 OS=Xenopus tropicalis GN=usp15 PE=2 SV=2 300 415 2.0E-07
sp|Q4R6X7|UBP16_MACFA Ubiquitin carboxyl-terminal hydrolase 16 OS=Macaca fascicularis GN=USP16 PE=2 SV=2 185 423 3.0E-07
sp|Q6PAW2|UBP16_XENLA Ubiquitin carboxyl-terminal hydrolase 16 OS=Xenopus laevis GN=usp16 PE=2 SV=1 185 415 3.0E-07
sp|A7Z056|UBP20_BOVIN Ubiquitin carboxyl-terminal hydrolase 20 OS=Bos taurus GN=USP20 PE=2 SV=1 176 432 4.0E-07
sp|Q9Y5T5|UBP16_HUMAN Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens GN=USP16 PE=1 SV=1 185 423 4.0E-07
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 154 249 4.0E-07
sp|Q2HJE4|UBP15_BOVIN Ubiquitin carboxyl-terminal hydrolase 15 OS=Bos taurus GN=USP15 PE=2 SV=1 300 415 5.0E-07
sp|Q08DA3|UBP16_BOVIN Ubiquitin carboxyl-terminal hydrolase 16 OS=Bos taurus GN=USP16 PE=2 SV=2 185 423 5.0E-07
sp|Q0V9G5|UBP44_XENTR Ubiquitin carboxyl-terminal hydrolase 44 OS=Xenopus tropicalis GN=usp44 PE=2 SV=1 151 249 6.0E-07
sp|A6QR55|UBP4_BOVIN Ubiquitin carboxyl-terminal hydrolase 4 OS=Bos taurus GN=USP4 PE=2 SV=1 300 415 6.0E-07
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 285 541 7.0E-07
sp|Q5RCD3|UBP4_PONAB Ubiquitin carboxyl-terminal hydrolase 4 OS=Pongo abelii GN=USP4 PE=2 SV=1 300 415 7.0E-07
sp|Q6NTR6|UP44A_XENLA Ubiquitin carboxyl-terminal hydrolase 44-A OS=Xenopus laevis GN=usp44-a PE=2 SV=1 151 249 8.0E-07
sp|Q13107|UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens GN=USP4 PE=1 SV=3 300 415 8.0E-07
sp|Q5XGZ2|UP44B_XENLA Ubiquitin carboxyl-terminal hydrolase 44-B OS=Xenopus laevis GN=usp44-b PE=2 SV=1 151 249 8.0E-07
sp|Q9Y4E8|UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens GN=USP15 PE=1 SV=3 300 415 1.0E-06
sp|Q8R5H1|UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus GN=Usp15 PE=1 SV=1 300 415 1.0E-06
sp|Q9R085|UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus GN=Usp15 PE=1 SV=1 300 415 1.0E-06
sp|A0JM59|UBP20_XENTR Ubiquitin carboxyl-terminal hydrolase 20 OS=Xenopus tropicalis GN=usp20 PE=2 SV=1 174 431 1.0E-06
sp|Q6GL77|UBXN1_XENTR UBX domain-containing protein 1 OS=Xenopus tropicalis GN=ubxn1 PE=2 SV=1 586 652 3.0E-06
sp|Q8C2S0|UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus GN=Usp44 PE=2 SV=3 154 249 3.0E-06
sp|Q6IP50|UBX1A_XENLA UBX domain-containing protein 1-A OS=Xenopus laevis GN=ubxn1-a PE=2 SV=1 586 634 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0008270 zinc ion binding Yes
GO:0016579 protein deubiquitination Yes
GO:0044238 primary metabolic process No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0019538 protein metabolic process No
GO:0006508 proteolysis No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0006807 nitrogen compound metabolic process No
GO:0043169 cation binding No
GO:0101005 deubiquitinase activity No
GO:0043167 ion binding No
GO:0046872 metal ion binding No
GO:0008233 peptidase activity No
GO:0070647 protein modification by small protein conjugation or removal No
GO:1901564 organonitrogen compound metabolic process No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0070646 protein modification by small protein removal No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0036211 protein modification process No
GO:0043170 macromolecule metabolic process No
GO:0008234 cysteine-type peptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5397
MPCPHFDSLGAGLSPPTPAQAVYREDCTQCFDSIDDPSGLDVCLQCFNGGCVGERRHSKLHSSAWNHPLALNIRR
TRKAVVRDEPPPKMSKLAIAAESDDDRYSTALTAKCVDCNTQLDMNDPRLAPVIDGIVKANTFARKEEVKAWEQE
LTSCEHILLLQQHAPRTIEQGQLGHCSACDLRENLWLCLECGNLGCGRKQMGGVDGNSHALSHSTQSGHGVAVKL
GSITPEGTADVYCYKCDDERVDDSLGQHLAHWGIMLAERQKTEKSLTEMQIEQNLKWDFSMTTEGGKELRPLFGP
GLTGLRNLGNSCYLASIAQCLFDMPSFRERYFRPADQPPAVQEPAADLETQLRKLADGLLSGRYSKPDENLASES
EVTHQKGLAPAMFKHLIGRGHPEFSTMRQQDAFELLQHLFKLITRSQHSGQLKDPTAPFRFVLEQRLQCLGCSKV
RYTAHEQDNIFIEVPLEKSTEADGSSGDVGDKYSPVTLKQCLDNLTAAEKVELSCSACGSSRGFTKQSLFKTFPD
VLVVNAHKMTVVNWVPVKVDVPVIVPDEPFLLDTYLSKGLQPSEELLPDEPEAPIPSFVPEATALAQLEAMGFPR
NRCEKALHATGNSDANAGMEWIFTHMDDADIDAPLNLGGQSGVADAGTDDPQKTEMLGAMGFDALHAKKALRETG
GDMERAVEWLFSHPDTDIVEYDEPAAKGPAGSASLPASFQLQSIVCHKGTSIHAGHYVAFIRKRQGSDWVLFNDE
KVVEAYDFEEMRKFAYIYFFRRT*
Coding >Hirsu2|5397
ATGCCGTGTCCTCACTTCGACTCACTCGGCGCCGGTCTCTCACCGCCGACACCCGCCCAGGCCGTCTACCGTGAG
GACTGCACGCAGTGCTTCGATTCCATCGACGACCCCAGCGGTCTCGATGTCTGCCTCCAGTGCTTCAACGGCGGC
TGCGTAGGGGAAAGGCGGCACAGCAAGCTGCACAGCAGCGCCTGGAATCACCCGCTGGCCCTCAACATTCGACGG
ACACGCAAGGCCGTTGTGCGGGATGAGCCCCCGCCCAAGATGTCTAAGCTTGCCATTGCCGCCGAGTCAGACGAC
GACCGATACAGCACAGCCCTTACCGCAAAGTGCGTCGATTGCAACACTCAGCTGGACATGAACGACCCGAGACTT
GCCCCTGTCATTGATGGCATTGTCAAGGCCAACACATTTGCGAGGAAGGAAGAGGTCAAAGCCTGGGAGCAGGAG
CTGACGTCCTGTGAGCACATCCTGCTACTGCAGCAGCATGCCCCCCGCACCATTGAGCAGGGCCAGCTTGGCCAC
TGCTCCGCCTGCGACCTGCGCGAAAACCTGTGGCTGTGTCTGGAGTGTGGCAACCTGGGTTGTGGCCGCAAGCAG
ATGGGTGGTGTCGACGGCAACTCCCATGCCCTGAGCCATTCCACCCAATCGGGCCATGGTGTAGCCGTCAAGCTG
GGCTCCATCACCCCCGAGGGCACTGCCGATGTTTACTGCTACAAGTGCGACGACGAGCGCGTCGACGACAGCCTT
GGCCAGCACTTGGCCCATTGGGGCATCATGTTGGCCGAGCGACAAAAAACTGAGAAGAGCTTGACGGAGATGCAA
ATCGAGCAGAATCTCAAATGGGATTTCAGCATGACCACCGAGGGCGGAAAGGAACTGAGACCTTTGTTCGGGCCT
GGCCTCACCGGACTTCGGAACTTGGGCAACAGTTGCTATCTGGCCAGTATCGCGCAGTGTCTCTTCGATATGCCA
TCCTTCCGGGAGCGGTACTTCCGGCCGGCCGACCAACCGCCCGCTGTGCAGGAACCCGCGGCCGACCTAGAAACT
CAGCTGCGAAAACTGGCCGACGGCCTGTTGTCGGGGCGATACTCGAAGCCCGACGAGAACTTGGCCTCGGAGTCA
GAGGTCACTCACCAGAAGGGCCTGGCGCCGGCCATGTTCAAGCATCTGATTGGCAGGGGCCATCCCGAGTTTTCA
ACCATGAGGCAGCAGGATGCCTTCGAGCTACTGCAGCACCTCTTCAAGCTCATCACGAGATCGCAGCACAGCGGC
CAGCTGAAGGACCCAACAGCCCCTTTTCGTTTTGTCCTGGAGCAGAGGCTGCAGTGTCTCGGATGCTCCAAAGTC
AGGTATACGGCACACGAGCAGGACAACATCTTCATTGAGGTTCCCCTCGAGAAGTCCACCGAGGCAGACGGTTCC
TCCGGGGATGTTGGCGACAAGTACAGTCCTGTCACCCTCAAGCAGTGCCTTGACAACTTGACGGCCGCGGAAAAG
GTGGAGCTGTCTTGCTCGGCCTGCGGGAGCTCGCGCGGCTTCACCAAACAGTCGCTCTTCAAGACCTTCCCCGAC
GTGCTCGTCGTCAATGCGCACAAGATGACCGTCGTCAACTGGGTGCCGGTCAAGGTCGACGTCCCCGTTATTGTC
CCCGACGAACCTTTCCTGCTGGACACGTACCTGTCCAAGGGTCTGCAGCCTTCGGAGGAGCTGCTCCCCGACGAG
CCCGAGGCCCCAATCCCGTCCTTCGTTCCGGAAGCCACCGCACTGGCCCAGCTCGAGGCCATGGGATTCCCCCGC
AACCGCTGTGAGAAGGCACTGCACGCAACCGGCAATTCGGACGCCAACGCCGGCATGGAGTGGATATTTACCCAC
ATGGACGATGCGGACATCGACGCACCCCTAAACCTCGGTGGCCAGTCGGGAGTGGCAGATGCCGGCACCGACGAC
CCACAGAAAACTGAGATGTTGGGAGCCATGGGCTTTGACGCTCTCCATGCGAAAAAGGCTCTTAGGGAGACGGGC
GGCGACATGGAGCGTGCTGTGGAGTGGCTTTTCAGCCACCCCGACACGGACATAGTGGAATACGACGAGCCGGCC
GCCAAGGGACCTGCCGGAAGCGCATCGCTGCCTGCCAGCTTCCAGCTTCAGTCCATCGTCTGCCACAAGGGGACG
AGTATCCATGCCGGCCACTATGTCGCGTTCATTCGGAAGCGCCAGGGCTCCGACTGGGTGCTCTTCAACGACGAG
AAAGTCGTCGAGGCATATGATTTTGAGGAGATGCGCAAATTTGCGTACATCTATTTCTTCCGACGCACGTGA
Transcript >Hirsu2|5397
ATGCCGTGTCCTCACTTCGACTCACTCGGCGCCGGTCTCTCACCGCCGACACCCGCCCAGGCCGTCTACCGTGAG
GACTGCACGCAGTGCTTCGATTCCATCGACGACCCCAGCGGTCTCGATGTCTGCCTCCAGTGCTTCAACGGCGGC
TGCGTAGGGGAAAGGCGGCACAGCAAGCTGCACAGCAGCGCCTGGAATCACCCGCTGGCCCTCAACATTCGACGG
ACACGCAAGGCCGTTGTGCGGGATGAGCCCCCGCCCAAGATGTCTAAGCTTGCCATTGCCGCCGAGTCAGACGAC
GACCGATACAGCACAGCCCTTACCGCAAAGTGCGTCGATTGCAACACTCAGCTGGACATGAACGACCCGAGACTT
GCCCCTGTCATTGATGGCATTGTCAAGGCCAACACATTTGCGAGGAAGGAAGAGGTCAAAGCCTGGGAGCAGGAG
CTGACGTCCTGTGAGCACATCCTGCTACTGCAGCAGCATGCCCCCCGCACCATTGAGCAGGGCCAGCTTGGCCAC
TGCTCCGCCTGCGACCTGCGCGAAAACCTGTGGCTGTGTCTGGAGTGTGGCAACCTGGGTTGTGGCCGCAAGCAG
ATGGGTGGTGTCGACGGCAACTCCCATGCCCTGAGCCATTCCACCCAATCGGGCCATGGTGTAGCCGTCAAGCTG
GGCTCCATCACCCCCGAGGGCACTGCCGATGTTTACTGCTACAAGTGCGACGACGAGCGCGTCGACGACAGCCTT
GGCCAGCACTTGGCCCATTGGGGCATCATGTTGGCCGAGCGACAAAAAACTGAGAAGAGCTTGACGGAGATGCAA
ATCGAGCAGAATCTCAAATGGGATTTCAGCATGACCACCGAGGGCGGAAAGGAACTGAGACCTTTGTTCGGGCCT
GGCCTCACCGGACTTCGGAACTTGGGCAACAGTTGCTATCTGGCCAGTATCGCGCAGTGTCTCTTCGATATGCCA
TCCTTCCGGGAGCGGTACTTCCGGCCGGCCGACCAACCGCCCGCTGTGCAGGAACCCGCGGCCGACCTAGAAACT
CAGCTGCGAAAACTGGCCGACGGCCTGTTGTCGGGGCGATACTCGAAGCCCGACGAGAACTTGGCCTCGGAGTCA
GAGGTCACTCACCAGAAGGGCCTGGCGCCGGCCATGTTCAAGCATCTGATTGGCAGGGGCCATCCCGAGTTTTCA
ACCATGAGGCAGCAGGATGCCTTCGAGCTACTGCAGCACCTCTTCAAGCTCATCACGAGATCGCAGCACAGCGGC
CAGCTGAAGGACCCAACAGCCCCTTTTCGTTTTGTCCTGGAGCAGAGGCTGCAGTGTCTCGGATGCTCCAAAGTC
AGGTATACGGCACACGAGCAGGACAACATCTTCATTGAGGTTCCCCTCGAGAAGTCCACCGAGGCAGACGGTTCC
TCCGGGGATGTTGGCGACAAGTACAGTCCTGTCACCCTCAAGCAGTGCCTTGACAACTTGACGGCCGCGGAAAAG
GTGGAGCTGTCTTGCTCGGCCTGCGGGAGCTCGCGCGGCTTCACCAAACAGTCGCTCTTCAAGACCTTCCCCGAC
GTGCTCGTCGTCAATGCGCACAAGATGACCGTCGTCAACTGGGTGCCGGTCAAGGTCGACGTCCCCGTTATTGTC
CCCGACGAACCTTTCCTGCTGGACACGTACCTGTCCAAGGGTCTGCAGCCTTCGGAGGAGCTGCTCCCCGACGAG
CCCGAGGCCCCAATCCCGTCCTTCGTTCCGGAAGCCACCGCACTGGCCCAGCTCGAGGCCATGGGATTCCCCCGC
AACCGCTGTGAGAAGGCACTGCACGCAACCGGCAATTCGGACGCCAACGCCGGCATGGAGTGGATATTTACCCAC
ATGGACGATGCGGACATCGACGCACCCCTAAACCTCGGTGGCCAGTCGGGAGTGGCAGATGCCGGCACCGACGAC
CCACAGAAAACTGAGATGTTGGGAGCCATGGGCTTTGACGCTCTCCATGCGAAAAAGGCTCTTAGGGAGACGGGC
GGCGACATGGAGCGTGCTGTGGAGTGGCTTTTCAGCCACCCCGACACGGACATAGTGGAATACGACGAGCCGGCC
GCCAAGGGACCTGCCGGAAGCGCATCGCTGCCTGCCAGCTTCCAGCTTCAGTCCATCGTCTGCCACAAGGGGACG
AGTATCCATGCCGGCCACTATGTCGCGTTCATTCGGAAGCGCCAGGGCTCCGACTGGGTGCTCTTCAACGACGAG
AAAGTCGTCGAGGCATATGATTTTGAGGAGATGCGCAAATTTGCGTACATCTATTTCTTCCGACGCACGTGA
Gene >Hirsu2|5397
ATGCCGTGTCCTCACTTCGACTCACTCGGCGCCGGCAAGTCTTTCTGATCCATCTTAACGCCGTCGCGTTGATTG
TTGCTGCCTCTTCGCTAACCTCACATATTCTCCTCCAGGTCTCTCACCGCCGACACCCGCCCAGGCCGTCTACCG
TGAGGACTGCACGCAGTGCTTCGATTCCATCGTAGGCTCGCCCCCTCGTCGCAACCCTCGGGCCCCTCGAACCTT
TCGCCACTCTACATCTCCCTGGAAGTGTCTGATCTGGTCACAGGACGACCCCAGCGGTCTCGATGTCTGCCTCCA
GTGCTTCAACGGCGGCTGCGTAGGGGAAAGGCGGCACAGCAAGCTGCACAGCAGCGCCTGGAATCACCCGCTGGC
CCTCAACATTCGACGGACACGCAAGGCCGTTGTGCGGGATGAGCCCCCGCCCAAGATGTCTAAGCTTGCCATTGC
CGCCGAGTCAGACGACGACCGATACAGCACAGCCCTTACCGCAAAGTGCGTCGATTGCAACACTCAGCTGGACAT
GAACGACCCGAGACTTGCCCCTGTCATTGATGGCATTGTCAAGGCCAACACATTTGCGAGGAAGGAAGAGGTCAA
AGCCTGGGAGCAGGAGCTGACGTCCTGTGAGCACATCCTGCTACTGCAGCAGCATGCCCCCCGCACCATTGAGCA
GGGCCAGCTTGGCCACTGCTCCGCCTGCGACCTGCGCGAAAACCTGTGGCTGTGTCTGGAGTGTGGCAACCTGGG
TTGTGGCCGCAAGCAGATGGGTGGTGTCGACGGCAACTCCCATGCCCTGAGCCATTCCACCCAATCGGGCCATGG
TGTAGCCGTCAAGCTGGGCTCCATCACCCCCGAGGGCACTGCCGATGTTTACTGCTACAAGTGCGACGACGAGCG
CGTCGACGACAGCCTTGGCCAGCACTTGGCCCATTGGGGCATCATGTTGGCCGAGCGACAAAAAACTGAGAAGAG
CTTGACGGAGATGCAAATCGAGCAGAATCTCAAATGGGATTTCAGCATGACCACCGAGGGCGGAAAGGAACTGAG
ACCTTTGTTCGGGCCTGGCCTCACCGGACTTCGGAACTTGGGCAACAGTTGCTATCTGGCCAGTATCGCGCAGTG
TCTCTTCGATATGCCATCCTTCCGGGAGCGGTACTTCCGGCCGGCCGACCAACCGCCCGCTGTGCAGGAACCCGC
GGCCGACCTAGAAACTCAGCTGCGAAAACTGGCCGACGGCCTGTTGTCGGGGCGATACTCGAAGCCCGACGAGAA
CTTGGCCTCGGAGTCAGAGGTCACTCACCAGAAGGGCCTGGCGCCGGCCATGTTCAAGCATCTGATTGGCAGGGG
CCATCCCGAGTTTTCAACCATGAGGCAGCAGGATGCCTTCGAGCTACTGCAGCACCTCTTCAAGCTCATCACGAG
ATCGCAGCACAGCGGCCAGCTGAAGGACCCAACAGCCCCTTTTCGTTTTGTCCTGGAGCAGAGGCTGCAGTGTCT
CGGATGCTCCAAAGTCAGGTATACGGCACACGAGCAGGACAACATCTTCATTGAGGTTCCCCTCGAGAAGTCCAC
CGAGGCAGACGGTTCCTCCGGGGATGTTGGCGACAAGTACAGTCCTGTCACCCTCAAGCAGTGCCTTGACAACTT
GACGGCCGCGGAAAAGGTGGAGCTGTCTTGCTCGGCCTGCGGGAGCTCGCGCGGCTTCACCAAACAGTCGCTCTT
CAAGACCTTCCCCGACGTGCTCGTCGTCAATGCGCACAAGATGACCGTCGTCAACTGGGTGCCGGTCAAGGTCGA
CGTCCCCGTTATTGTCCCCGACGAACCTTTCCTGCTGGACACGTACCTGTCCAAGGGTCTGCAGCCTTCGGAGGA
GCTGCTCCCCGACGAGCCCGAGGCCCCAATCCCGTCCTTCGTTCCGGAAGCCACCGCACTGGCCCAGCTCGAGGC
CATGGGATTCCCCCGCAACCGCTGTGAGAAGGCACTGCACGCAACCGGCAATTCGGACGCCAACGCCGGCATGGA
GTGGATATTTACCCACATGGACGATGCGGACATCGACGCACCCCTAAACCTCGGTGGCCAGTCGGGAGTGGCAGA
TGCCGGCACCGACGACCCACAGAAAACTGAGATGTTGGGAGCCATGGGCTTTGACGCTCTCCATGCGAAAAAGGC
TCTTAGGGAGACGGGCGGCGACATGGAGCGTGCTGTGGAGTGGCTTTTCAGCCACCCCGACACGGACATAGTGGA
ATACGACGAGCCGGCCGCCAAGGGACCTGCCGGAAGCGCATCGCTGCCTGCCAGCTTCCAGCTTCAGTCCATCGT
CTGCCACAAGGGGACGAGTATCCATGCCGGGTAGGTGGAAGGAACTCATCTCTGCCGTGACACCATGTGCTAATC
TTCGCGTGGCCAGCCACTATGTCGCGTTCATTCGGAAGCGCCAGGGCTCCGACTGGGTGCTCTTCAACGACGAGA
AAGTCGTCGAGGCATATGATTTTGAGGAGATGCGCAAATTTGCGTACATCTATTTCTTCCGACGCACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail