Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5392
Gene name
LocationContig_27:25882..27718
Strand+
Gene length (bp)1836
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04506 Rft-1 Rft protein 1.3E-141 6 567

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C6S3|RFT1_YARLI Oligosaccharide translocation protein RFT1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RFT1 PE=3 SV=1 9 520 2.0E-82
sp|Q754Q7|RFT1_ASHGO Oligosaccharide translocation protein RFT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RFT1 PE=3 SV=1 8 565 2.0E-67
sp|P38206|RFT1_YEAST Oligosaccharide translocation protein RFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFT1 PE=1 SV=1 9 495 5.0E-67
sp|Q5A6N8|RFT1_CANAL Oligosaccharide translocation protein RFT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFT1 PE=3 SV=1 3 509 1.0E-63
sp|P40913|RFT1_KLULA Oligosaccharide translocation protein RFT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RFT1 PE=3 SV=2 8 525 2.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6C6S3|RFT1_YARLI Oligosaccharide translocation protein RFT1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RFT1 PE=3 SV=1 9 520 2.0E-82
sp|Q754Q7|RFT1_ASHGO Oligosaccharide translocation protein RFT1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RFT1 PE=3 SV=1 8 565 2.0E-67
sp|P38206|RFT1_YEAST Oligosaccharide translocation protein RFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFT1 PE=1 SV=1 9 495 5.0E-67
sp|Q5A6N8|RFT1_CANAL Oligosaccharide translocation protein RFT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RFT1 PE=3 SV=1 3 509 1.0E-63
sp|P40913|RFT1_KLULA Oligosaccharide translocation protein RFT1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RFT1 PE=3 SV=2 8 525 2.0E-63
sp|Q6FPE8|RFT1_CANGA Oligosaccharide translocation protein RFT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RFT1 PE=3 SV=1 8 565 4.0E-59
sp|O94302|RFT1_SCHPO Oligosaccharide translocation protein rft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rft1 PE=3 SV=1 14 512 1.0E-53
sp|Q96AA3|RFT1_HUMAN Protein RFT1 homolog OS=Homo sapiens GN=RFT1 PE=1 SV=1 14 496 2.0E-36
sp|Q0D2E8|RFT1_XENTR Protein RFT1 homolog OS=Xenopus tropicalis GN=rft1 PE=2 SV=1 10 562 8.0E-35
sp|Q8C3B8|RFT1_MOUSE Protein RFT1 homolog OS=Mus musculus GN=Rft1 PE=2 SV=2 14 496 1.0E-32
sp|Q54IV7|RFT1_DICDI Protein RFT1 homolog OS=Dictyostelium discoideum GN=rft1 PE=3 SV=1 9 481 2.0E-24
sp|Q9Y123|RFT1_DROME Protein RFT1 homolog OS=Drosophila melanogaster GN=CG3149 PE=2 SV=1 273 518 4.0E-22
sp|Q23444|RFT1_CAEEL Protein RFT1 homolog OS=Caenorhabditis elegans GN=ZK180.3 PE=3 SV=1 17 504 1.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0006869 lipid transport Yes
GO:0016021 integral component of membrane Yes
GO:0005319 lipid transporter activity Yes
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0071702 organic substance transport No
GO:0044425 membrane part No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 112 134 22
3 156 178 22
4 190 212 22
5 222 244 22
6 376 398 22
7 411 433 22
8 446 463 17
9 468 490 22
10 503 525 22
11 535 557 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5392
MAASSMVQGASLLVLLQLLSRLTSFAANQLLVRLLTARLLGLATQLDVLYLSVLFFARESLRVAIQRQAPSPPAI
RPAAAEVGGDKARDATEAKRREEQREREDERRGAQAVVNLGYLPVLVGAVVAVVLARLYRAYLVVDSSSSLGDDD
GQPPQLVLALGLYALAAWVELLSEPCFVLMHTRLRFGTRAAAESAATLTRCLVVLGAALWASSEEEGGGRGVVGV
LPFALGQLAYGLALLLVYLVAGRRLAAQLGFSLLPRRLGGGKGFVLGYFDAPALRLAASITAQSVVKHVLTQGDT
FLVSLLAEAEVQGVYALANNYGGLLARLLFQPVEESCRSYFSRLLSSSSPAAAAASSRSPAAVEARRSLATLSRL
YLVLSAAVVAVGPFAAPALLAVVAGSRWTAVGAGRVLATYCFYVPFLALNGLAESFVASVASERQLHRQSLWMGA
FSVAFAAAAYVLMRLYPLGAHGLVLANVVNMLCRILWSTAFVKTFFAARRLDFSLASLLPGPTIAASLATFAALV
QLHDLDEAGARPFVTLAKVAASAVPLLLVIGFSERTLLLECFHSVRGREFAKP*
Coding >Hirsu2|5392
ATGGCGGCGTCGTCGATGGTGCAGGGCGCGTCGCTGCTCGTGCTGCTGCAGCTGCTGTCGCGGCTGACGAGCTTC
GCGGCCAACCAGCTGCTCGTGCGGCTGCTGACGGCGCGGCTGCTGGGGCTGGCGACGCAGCTCGACGTGCTGTAC
CTGTCGGTCCTGTTCTTCGCGCGCGAGAGCCTGCGCGTCGCAATCCAGCGCCAGGCGCCGTCGCCGCCCGCGATC
CGCCCTGCCGCTGCCGAGGTCGGTGGCGATAAGGCGCGGGACGCGACGGAGGCGAAAAGGAGAGAAGAGCAGAGG
GAGAGGGAAGACGAGAGGCGGGGCGCCCAGGCCGTCGTCAACCTCGGCTACCTCCCCGTCTTGGTCGGCGCCGTC
GTCGCCGTCGTCCTCGCCCGCCTCTACCGCGCCTACCTCGTCGTCGACAGCAGCAGCAGCCTCGGCGACGACGAT
GGCCAGCCGCCGCAGCTGGTGCTCGCTCTTGGCCTCTACGCCCTCGCCGCCTGGGTCGAGCTCCTGTCGGAGCCG
TGCTTTGTGCTGATGCACACGCGCCTGCGCTTCGGCACCCGCGCCGCCGCCGAGTCGGCCGCGACGCTGACGCGC
TGCCTCGTCGTCCTTGGCGCCGCCCTGTGGGCTTCCTCGGAGGAGGAGGGGGGGGGCCGCGGCGTCGTCGGCGTC
TTGCCCTTTGCCCTCGGCCAGCTGGCGTACGGGCTGGCGCTGCTGCTCGTCTACCTCGTCGCCGGCCGCCGGCTC
GCCGCCCAGCTCGGCTTCTCCCTTTTGCCTAGGCGCCTGGGCGGCGGCAAAGGCTTCGTGCTCGGCTACTTCGAC
GCGCCCGCGCTGCGGCTGGCGGCCAGCATCACGGCCCAGAGCGTCGTCAAGCACGTCCTCACCCAGGGCGACACC
TTCCTCGTCTCGCTGCTGGCCGAGGCCGAGGTGCAGGGCGTCTACGCCCTCGCCAACAACTACGGCGGCCTGCTG
GCCCGGCTGCTGTTCCAGCCGGTCGAGGAGAGTTGCCGCAGCTACTTCTCGCGCCTGCTGTCCTCGTCGTCGCCC
GCCGCCGCCGCCGCCTCCTCCAGGTCGCCCGCCGCCGTCGAGGCCCGCCGCAGCCTCGCCACCCTGTCAAGGCTG
TACCTCGTCCTCTCGGCCGCCGTCGTCGCCGTCGGGCCCTTCGCCGCTCCGGCCCTCCTGGCCGTCGTCGCCGGC
AGCCGCTGGACCGCCGTCGGCGCCGGCCGCGTCCTCGCCACCTACTGCTTCTACGTGCCCTTCCTCGCCCTCAAC
GGCCTGGCCGAGTCCTTCGTCGCGTCCGTCGCGTCGGAGCGCCAGCTCCACCGTCAGTCGCTCTGGATGGGCGCC
TTCTCCGTCGCCTTCGCCGCCGCCGCCTACGTCCTCATGCGCCTTTACCCGCTCGGCGCCCACGGCCTCGTCCTC
GCCAACGTCGTCAACATGCTGTGCCGCATTCTGTGGAGCACCGCCTTCGTCAAGACCTTCTTCGCCGCCCGCCGC
CTCGACTTCTCCCTCGCCTCGCTGCTGCCCGGCCCGACCATTGCCGCCTCGCTCGCCACCTTTGCCGCTCTCGTC
CAGCTGCATGACCTGGACGAGGCCGGCGCCAGGCCCTTTGTCACTCTCGCCAAGGTCGCGGCCTCGGCGGTGCCC
TTACTGCTCGTCATAGGTTTCTCCGAGAGGACTCTTCTCCTCGAGTGCTTTCACTCGGTACGCGGCCGGGAATTC
GCCAAGCCGTGA
Transcript >Hirsu2|5392
ATGGCGGCGTCGTCGATGGTGCAGGGCGCGTCGCTGCTCGTGCTGCTGCAGCTGCTGTCGCGGCTGACGAGCTTC
GCGGCCAACCAGCTGCTCGTGCGGCTGCTGACGGCGCGGCTGCTGGGGCTGGCGACGCAGCTCGACGTGCTGTAC
CTGTCGGTCCTGTTCTTCGCGCGCGAGAGCCTGCGCGTCGCAATCCAGCGCCAGGCGCCGTCGCCGCCCGCGATC
CGCCCTGCCGCTGCCGAGGTCGGTGGCGATAAGGCGCGGGACGCGACGGAGGCGAAAAGGAGAGAAGAGCAGAGG
GAGAGGGAAGACGAGAGGCGGGGCGCCCAGGCCGTCGTCAACCTCGGCTACCTCCCCGTCTTGGTCGGCGCCGTC
GTCGCCGTCGTCCTCGCCCGCCTCTACCGCGCCTACCTCGTCGTCGACAGCAGCAGCAGCCTCGGCGACGACGAT
GGCCAGCCGCCGCAGCTGGTGCTCGCTCTTGGCCTCTACGCCCTCGCCGCCTGGGTCGAGCTCCTGTCGGAGCCG
TGCTTTGTGCTGATGCACACGCGCCTGCGCTTCGGCACCCGCGCCGCCGCCGAGTCGGCCGCGACGCTGACGCGC
TGCCTCGTCGTCCTTGGCGCCGCCCTGTGGGCTTCCTCGGAGGAGGAGGGGGGGGGCCGCGGCGTCGTCGGCGTC
TTGCCCTTTGCCCTCGGCCAGCTGGCGTACGGGCTGGCGCTGCTGCTCGTCTACCTCGTCGCCGGCCGCCGGCTC
GCCGCCCAGCTCGGCTTCTCCCTTTTGCCTAGGCGCCTGGGCGGCGGCAAAGGCTTCGTGCTCGGCTACTTCGAC
GCGCCCGCGCTGCGGCTGGCGGCCAGCATCACGGCCCAGAGCGTCGTCAAGCACGTCCTCACCCAGGGCGACACC
TTCCTCGTCTCGCTGCTGGCCGAGGCCGAGGTGCAGGGCGTCTACGCCCTCGCCAACAACTACGGCGGCCTGCTG
GCCCGGCTGCTGTTCCAGCCGGTCGAGGAGAGTTGCCGCAGCTACTTCTCGCGCCTGCTGTCCTCGTCGTCGCCC
GCCGCCGCCGCCGCCTCCTCCAGGTCGCCCGCCGCCGTCGAGGCCCGCCGCAGCCTCGCCACCCTGTCAAGGCTG
TACCTCGTCCTCTCGGCCGCCGTCGTCGCCGTCGGGCCCTTCGCCGCTCCGGCCCTCCTGGCCGTCGTCGCCGGC
AGCCGCTGGACCGCCGTCGGCGCCGGCCGCGTCCTCGCCACCTACTGCTTCTACGTGCCCTTCCTCGCCCTCAAC
GGCCTGGCCGAGTCCTTCGTCGCGTCCGTCGCGTCGGAGCGCCAGCTCCACCGTCAGTCGCTCTGGATGGGCGCC
TTCTCCGTCGCCTTCGCCGCCGCCGCCTACGTCCTCATGCGCCTTTACCCGCTCGGCGCCCACGGCCTCGTCCTC
GCCAACGTCGTCAACATGCTGTGCCGCATTCTGTGGAGCACCGCCTTCGTCAAGACCTTCTTCGCCGCCCGCCGC
CTCGACTTCTCCCTCGCCTCGCTGCTGCCCGGCCCGACCATTGCCGCCTCGCTCGCCACCTTTGCCGCTCTCGTC
CAGCTGCATGACCTGGACGAGGCCGGCGCCAGGCCCTTTGTCACTCTCGCCAAGGTCGCGGCCTCGGCGGTGCCC
TTACTGCTCGTCATAGGTTTCTCCGAGAGGACTCTTCTCCTCGAGTGCTTTCACTCGGTACGCGGCCGGGAATTC
GCCAAGCCGTGA
Gene >Hirsu2|5392
ATGGCGGCGTCGTCGATGGTGCAGGGCGCGTCGCTGCTCGTGCTGCTGCAGCTGCTGTCGCGGCTGACGAGCTTC
GCGGCCAACCAGCTGCTCGTGCGGCTGCTGACGGCGCGGCTGCTGGGGCTGGCGACGCAGCTCGACGTGCTGTAC
CTGTCGGTCCTGTTCTTCGCGCGCGAGAGCCTGCGCGTCGCAATCCAGCGCCAGGCGCCGTCGCCGCCCGCGATC
CGCCCTGCCGCTGCCGAGGTCGGTGGCGATAAGGCGCGGGACGCGACGGAGGCGAAAAGGAGAGAAGAGCAGAGG
GAGAGGGAAGACGAGAGGCGGGGCGCCCAGGCCGTCGTCAACCTCGGCTACCTCCCCGTCTTGGTCGGCGCCGTC
GTCGCCGTCGTCCTCGCCCGCCTCTACCGCGCCTACCTCGTCGTCGACAGCAGCAGCAGCCTCGGCGACGACGAT
GGCCAGCCGCCGCAGCTGGTGCTCGCTCTTGGCCTCTACGCCCTCGCCGCCTGGGTCGAGCTCCTGTCGGAGCCG
TGCTTTGTGCTGATGCACACGCGCCTGCGCTTCGGCACCCGCGCCGCCGCCGAGTCGGCCGCGACGCTGACGCGC
TGCCTCGTCGTCCTTGGCGCCGCCCTGTGGGCTTCCTCGGAGGAGGAGGGGGGGGGCCGCGGCGTCGTCGGCGTC
TTGCCCTTTGCCCTCGGCCAGCTGGCGTACGGGCTGGCGCTGCTGCTCGTCTACCTCGTCGCCGGCCGCCGGCTC
GCCGCCCAGCTCGGCTTCTCCCTTTTGCCTAGGCGCCTGGGCGGCGGCAAAGGCTTCGTGCTCGGCTACTTCGAC
GCGCCCGCGCTGCGGCTGGCGGCCAGCATCACGGCCCAGAGCGTCGTCAAGCACGTCCTCACCCAGGGCGACACC
TTCCTCGTCTCGCTGCTGGCCGAGGCCGAGGTGCAGGGCGTCTACGCCCTCGCCAACAACTACGGCGGCCTGCTG
GCCCGGCTGCTGTTCCAGCCGGTCGAGGAGAGTTGCCGCAGCTACTTCTCGCGCCTGCTGTCCTCGTCGTCGCCC
GCCGCCGCCGCCGCCTCCTCCAGGTCGCCCGCCGCCGTCGAGGCCCGCCGCAGCCTCGCCACCCTGTCAAGGCTG
TACCTCGTCCTCTCGGCCGCCGTCGTCGCCGTCGGGCCCTTCGCCGCTCCGGCCCTCCTGGCCGTCGTCGCCGGC
AGCCGCTGGACCGCCGTCGGCGCCGGCCGCGTCCTCGCCACCTACTGCTTCTACGTGCCCTTCCTCGCCCTCAAC
GGCCTGGCCGAGTCCTTCGTCGCGTCCGTCGCGTCGGAGCGCCAGCTCCACCGTCAGTCGCTCTGGATGGGCGCC
TTCTCCGTCGCCTTCGCCGCCGCCGCCTACGTCCTCATGCGCCTTTACCCGCTCGGCGCCCACGGCCTCGTCCTC
GCCAACGTCGTCAACATGCTGTGCCGCATTCTGTGGAGCACCGCCTTCGTCAAGACCTTCTTCGCCGCCCGCCGC
CTCGACTTCTCCCTCGCCTCGCTGCTGCCCGGCCCGACCATTGCCGCCTCGCTCGCCACCTTTGCCGCTCTCGTC
CAGCTGCATGACCTGGACGAGGCCGGCGCCAGGCCCTTTGTCACTCTCGCCAAGGTCGCGGCCTCGGCGGTGCCC
TTACTGCTCGTCATGTACGTGGTTTTCGAACGCTTCCCTCTTTTATTTTCCCTTTCCGCAGCCATATATGAACAT
GCATCTATGTACCGCCCCTCTAACCAATTCGCGAACAGAGGTTTCTCCGAGAGGACTCTTCTCCTCGAGTGCTTT
CACTCGGTACGCGGCCGGGAATTCGCCAAGCCGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail