Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5391
Gene name
LocationContig_27:22918..24752
Strand+
Gene length (bp)1834
Transcript length (bp)1725
Coding sequence length (bp)1725
Protein length (aa) 575

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03055 RPE65 Retinal pigment epithelial membrane protein 2.5E-114 43 571

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JJS6|BCDO1_MOUSE Beta,beta-carotene 15,15'-dioxygenase OS=Mus musculus GN=Bco1 PE=1 SV=2 45 571 1.0E-41
sp|Q91XT5|BCDO1_RAT Beta,beta-carotene 15,15'-dioxygenase OS=Rattus norvegicus GN=Bco1 PE=2 SV=1 45 571 2.0E-41
sp|Q9HAY6|BCDO1_HUMAN Beta,beta-carotene 15,15'-dioxygenase OS=Homo sapiens GN=BCO1 PE=1 SV=1 45 568 2.0E-39
sp|Q9YGX2|RPE65_CHICK Retinoid isomerohydrolase OS=Gallus gallus GN=RPE65 PE=1 SV=1 41 568 2.0E-39
sp|A9C3R8|RP65C_DANRE Retinal Mueller cells isomerohydrolase OS=Danio rerio GN=rpe65c PE=1 SV=1 41 571 2.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9JJS6|BCDO1_MOUSE Beta,beta-carotene 15,15'-dioxygenase OS=Mus musculus GN=Bco1 PE=1 SV=2 45 571 1.0E-41
sp|Q91XT5|BCDO1_RAT Beta,beta-carotene 15,15'-dioxygenase OS=Rattus norvegicus GN=Bco1 PE=2 SV=1 45 571 2.0E-41
sp|Q9HAY6|BCDO1_HUMAN Beta,beta-carotene 15,15'-dioxygenase OS=Homo sapiens GN=BCO1 PE=1 SV=1 45 568 2.0E-39
sp|Q9YGX2|RPE65_CHICK Retinoid isomerohydrolase OS=Gallus gallus GN=RPE65 PE=1 SV=1 41 568 2.0E-39
sp|A9C3R8|RP65C_DANRE Retinal Mueller cells isomerohydrolase OS=Danio rerio GN=rpe65c PE=1 SV=1 41 571 2.0E-38
sp|Q9XT71|RPE65_CHLAE Retinoid isomerohydrolase OS=Chlorocebus aethiops GN=RPE65 PE=2 SV=3 41 568 3.0E-38
sp|Q16518|RPE65_HUMAN Retinoid isomerohydrolase OS=Homo sapiens GN=RPE65 PE=1 SV=3 41 568 3.0E-38
sp|Q91ZQ5|RPE65_MOUSE Retinoid isomerohydrolase OS=Mus musculus GN=Rpe65 PE=1 SV=4 41 568 5.0E-38
sp|A9C3R9|RP65B_DANRE All-trans-retinyl ester 13-cis isomerohydrolase OS=Danio rerio GN=rpe65b PE=1 SV=1 41 571 7.0E-38
sp|Q9I993|BCDO1_CHICK Beta,beta-carotene 15,15'-dioxygenase OS=Gallus gallus GN=BCO1 PE=1 SV=1 45 571 8.0E-38
sp|O70276|RPE65_RAT Retinoid isomerohydrolase OS=Rattus norvegicus GN=Rpe65 PE=2 SV=4 41 568 1.0E-37
sp|Q99NF1|BCDO2_MOUSE Beta,beta-carotene 9',10'-oxygenase OS=Mus musculus GN=Bco2 PE=1 SV=1 45 572 3.0E-37
sp|Q6PBW5|RP65A_DANRE Retinoid isomerohydrolase OS=Danio rerio GN=rpe65a PE=2 SV=1 41 571 4.0E-37
sp|Q28175|RPE65_BOVIN Retinoid isomerohydrolase OS=Bos taurus GN=RPE65 PE=1 SV=3 41 568 6.0E-37
sp|Q9TVB8|RPE65_CANLF Retinoid isomerohydrolase OS=Canis lupus familiaris GN=RPE65 PE=1 SV=3 41 568 8.0E-37
sp|Q9YI25|RPE65_AMBTI Retinoid isomerohydrolase OS=Ambystoma tigrinum GN=RPE65 PE=2 SV=3 41 567 7.0E-36
sp|Q8AXN9|RPE65_CYNPY Retinoid isomerohydrolase OS=Cynops pyrrhogaster GN=RPE65 PE=2 SV=3 41 569 3.0E-35
sp|A8Y9I2|NINAB_GALME Carotenoid isomerooxygenase OS=Galleria mellonella GN=ninaB PE=1 SV=1 45 571 1.0E-33
sp|Q8HXG8|BCDO2_MACFA Beta,beta-carotene 9',10'-oxygenase OS=Macaca fascicularis GN=BCO2 PE=2 SV=2 44 572 5.0E-32
sp|Q5RF16|BCDO2_PONAB Beta,beta-carotene 9',10'-oxygenase OS=Pongo abelii GN=BCO2 PE=2 SV=1 44 572 9.0E-32
sp|Q9BYV7|BCDO2_HUMAN Beta,beta-carotene 9',10'-oxygenase OS=Homo sapiens GN=BCO2 PE=1 SV=5 44 572 3.0E-31
sp|Q8VY26|CCD8_ARATH Carotenoid cleavage dioxygenase 8, chloroplastic OS=Arabidopsis thaliana GN=CCD8 PE=1 SV=1 38 571 1.0E-27
sp|Q8LIY8|CCD8B_ORYSJ Carotenoid cleavage dioxygenase 8 homolog B, chloroplastic OS=Oryza sativa subsp. japonica GN=CCD8B PE=1 SV=1 53 571 1.0E-24
sp|Q93VD5|CCD8A_ORYSJ Carotenoid cleavage dioxygenase 8 homolog A, chloroplastic OS=Oryza sativa subsp. japonica GN=CCD8A PE=2 SV=1 53 571 1.0E-23
sp|P74334|ACOX_SYNY3 Apocarotenoid-15,15'-oxygenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll1541 PE=1 SV=1 55 549 3.0E-19
sp|C3VEQ4|CCD1_ONCHC Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Oncidium hybrid cultivar GN=CCD1 PE=2 SV=1 53 568 3.0E-18
sp|Q8LP17|CCD1_PEA Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Pisum sativum GN=CCD1 PE=2 SV=1 36 568 4.0E-17
sp|Q94IR2|CCD1_PHAVU Carotenoid 9,10(9',10')-cleavage dioxygenase 1 OS=Phaseolus vulgaris GN=CCD1 PE=1 SV=1 53 568 8.0E-17
sp|Q84KG5|CCD_CROSA Carotenoid 9,10(9',10')-cleavage dioxygenase OS=Crocus sativus GN=CCD PE=1 SV=1 53 568 2.0E-15
sp|Q7XU29|CCD7_ORYSJ Carotenoid cleavage dioxygenase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=CCD7 PE=1 SV=2 357 568 3.0E-10
sp|Q9VFS2|NINAB_DROME Carotenoid isomerooxygenase OS=Drosophila melanogaster GN=ninaB PE=1 SV=1 466 571 5.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen Yes
GO:0055114 oxidation-reduction process Yes
GO:0016491 oxidoreductase activity No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0051213 dioxygenase activity No
GO:0016701 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5391
MAVNASGVLHRTAQNEVQDKEQSFRNVEDESWKDWPNHAGFEGLEEHRGPLKLRVKGSIPAWAAGSLYRTGPGQS
SVEDTSRGTHYVSHWFDGFAHTHKFDIVAPGEDGEETAVIYSSRRQSEDHVAQIKKTGWRSSTSFGQKADPCIGI
FAKFMSFFVPRRLNNNVACLPNFPGLQDNGPVSNQSGHRTGTSNIYISTDHCALQEISPDTLEPLGFVNQQRLHP
DLDGVLSCAHAQRDHETGDWFNFNLALGRQATYRVFRVNAILGTTDLLATISEPDLAAAYMHSFFLTENYVVLCI
PSSHFGWKGLKIMWEKNLLDAIKPFDEKRRCQWVVVDRKNDQGVVARFSTPAGFFFHSVNAFEELTKDETGSKRV
DLCLDHTMYDNTDIMFGLYYDVILDRKDAMREFVASGRHKTWQSRHVRYRFRMPVSGQTREEARAATAEQVFSIA
SPHSGELSTIHPGRTGRSYRYVYGTSNRGLSTFMDAIVKTDLDTHDAVLWSGPQAHTPGEPVFVPRPGGTDEDDG
VVLSVVLDGTAQRSYLLCLDARTMEETGRAEADFPIALGFHGFHAPVVT*
Coding >Hirsu2|5391
ATGGCGGTCAACGCATCCGGCGTTCTCCACCGCACCGCCCAGAACGAGGTCCAAGACAAAGAACAGTCGTTTCGC
AACGTCGAAGACGAGTCGTGGAAAGACTGGCCCAACCATGCCGGCTTTGAGGGCCTCGAGGAACACCGAGGTCCG
CTGAAGCTTCGCGTTAAGGGCTCCATCCCGGCCTGGGCTGCGGGCTCGCTATACCGAACAGGCCCCGGCCAGAGC
AGCGTCGAGGACACGTCCCGCGGGACGCACTACGTATCGCACTGGTTTGACGGCTTTGCCCACACCCACAAGTTC
GACATCGTGGCCCCGGGCGAGGACGGCGAGGAGACGGCCGTCATCTACTCGTCGCGGCGGCAGTCCGAAGACCAC
GTCGCCCAGATCAAGAAGACGGGCTGGCGCTCAAGCACCTCGTTTGGACAAAAAGCCGACCCCTGCATCGGCATC
TTCGCCAAATTCATGAGTTTTTTTGTGCCGCGCCGGCTGAACAACAATGTCGCCTGCCTGCCCAACTTCCCTGGC
CTGCAGGACAACGGGCCGGTGAGCAACCAGAGCGGCCATCGGACGGGGACGAGCAACATCTACATCAGCACAGAC
CACTGCGCCTTGCAGGAAATAAGCCCGGACACCCTGGAGCCCCTAGGATTCGTGAACCAGCAGCGCCTTCACCCG
GACCTCGACGGCGTCTTGTCCTGCGCACACGCCCAGCGGGACCACGAGACGGGAGATTGGTTCAACTTCAACCTG
GCCCTGGGCCGCCAGGCAACGTACCGCGTGTTTCGCGTAAACGCAATCCTTGGCACCACCGACCTCCTCGCCACC
ATCTCGGAGCCTGACTTGGCGGCCGCGTACATGCACAGCTTCTTCCTGACGGAGAACTATGTCGTGCTCTGCATC
CCGTCCAGCCACTTCGGATGGAAAGGGCTCAAGATCATGTGGGAGAAGAACCTGCTGGATGCCATCAAGCCCTTT
GACGAGAAGCGGCGGTGCCAGTGGGTGGTCGTGGACCGAAAGAACGACCAGGGCGTGGTCGCGCGCTTCTCGACG
CCCGCCGGCTTCTTCTTCCACTCGGTCAACGCGTTCGAGGAGCTCACTAAGGACGAGACTGGCTCGAAGCGAGTG
GACCTGTGCCTGGACCACACCATGTACGACAACACGGACATCATGTTCGGCCTCTACTACGATGTCATTCTGGAC
CGCAAAGATGCCATGAGGGAGTTTGTCGCGAGCGGACGGCACAAGACGTGGCAAAGTCGCCATGTGCGGTACCGC
TTCAGGATGCCCGTGTCGGGGCAGACGCGAGAGGAGGCCCGAGCGGCGACGGCCGAGCAGGTCTTTTCGATTGCC
AGCCCACATTCGGGGGAGCTGTCGACGATCCACCCCGGGCGGACGGGGCGGTCCTACCGATACGTATACGGGACG
AGCAACCGCGGGCTCAGCACTTTCATGGACGCGATCGTCAAGACAGATTTGGACACACACGATGCAGTCCTGTGG
AGCGGTCCGCAGGCGCACACGCCGGGCGAGCCCGTCTTTGTGCCACGGCCCGGTGGAACAGACGAGGACGATGGG
GTCGTCCTGAGCGTCGTTCTGGACGGCACTGCGCAGAGGTCGTATCTGCTGTGCCTGGACGCGAGGACGATGGAG
GAGACGGGGAGAGCCGAGGCCGACTTCCCCATCGCGCTCGGGTTCCATGGATTCCACGCGCCCGTCGTGACTTGA
Transcript >Hirsu2|5391
ATGGCGGTCAACGCATCCGGCGTTCTCCACCGCACCGCCCAGAACGAGGTCCAAGACAAAGAACAGTCGTTTCGC
AACGTCGAAGACGAGTCGTGGAAAGACTGGCCCAACCATGCCGGCTTTGAGGGCCTCGAGGAACACCGAGGTCCG
CTGAAGCTTCGCGTTAAGGGCTCCATCCCGGCCTGGGCTGCGGGCTCGCTATACCGAACAGGCCCCGGCCAGAGC
AGCGTCGAGGACACGTCCCGCGGGACGCACTACGTATCGCACTGGTTTGACGGCTTTGCCCACACCCACAAGTTC
GACATCGTGGCCCCGGGCGAGGACGGCGAGGAGACGGCCGTCATCTACTCGTCGCGGCGGCAGTCCGAAGACCAC
GTCGCCCAGATCAAGAAGACGGGCTGGCGCTCAAGCACCTCGTTTGGACAAAAAGCCGACCCCTGCATCGGCATC
TTCGCCAAATTCATGAGTTTTTTTGTGCCGCGCCGGCTGAACAACAATGTCGCCTGCCTGCCCAACTTCCCTGGC
CTGCAGGACAACGGGCCGGTGAGCAACCAGAGCGGCCATCGGACGGGGACGAGCAACATCTACATCAGCACAGAC
CACTGCGCCTTGCAGGAAATAAGCCCGGACACCCTGGAGCCCCTAGGATTCGTGAACCAGCAGCGCCTTCACCCG
GACCTCGACGGCGTCTTGTCCTGCGCACACGCCCAGCGGGACCACGAGACGGGAGATTGGTTCAACTTCAACCTG
GCCCTGGGCCGCCAGGCAACGTACCGCGTGTTTCGCGTAAACGCAATCCTTGGCACCACCGACCTCCTCGCCACC
ATCTCGGAGCCTGACTTGGCGGCCGCGTACATGCACAGCTTCTTCCTGACGGAGAACTATGTCGTGCTCTGCATC
CCGTCCAGCCACTTCGGATGGAAAGGGCTCAAGATCATGTGGGAGAAGAACCTGCTGGATGCCATCAAGCCCTTT
GACGAGAAGCGGCGGTGCCAGTGGGTGGTCGTGGACCGAAAGAACGACCAGGGCGTGGTCGCGCGCTTCTCGACG
CCCGCCGGCTTCTTCTTCCACTCGGTCAACGCGTTCGAGGAGCTCACTAAGGACGAGACTGGCTCGAAGCGAGTG
GACCTGTGCCTGGACCACACCATGTACGACAACACGGACATCATGTTCGGCCTCTACTACGATGTCATTCTGGAC
CGCAAAGATGCCATGAGGGAGTTTGTCGCGAGCGGACGGCACAAGACGTGGCAAAGTCGCCATGTGCGGTACCGC
TTCAGGATGCCCGTGTCGGGGCAGACGCGAGAGGAGGCCCGAGCGGCGACGGCCGAGCAGGTCTTTTCGATTGCC
AGCCCACATTCGGGGGAGCTGTCGACGATCCACCCCGGGCGGACGGGGCGGTCCTACCGATACGTATACGGGACG
AGCAACCGCGGGCTCAGCACTTTCATGGACGCGATCGTCAAGACAGATTTGGACACACACGATGCAGTCCTGTGG
AGCGGTCCGCAGGCGCACACGCCGGGCGAGCCCGTCTTTGTGCCACGGCCCGGTGGAACAGACGAGGACGATGGG
GTCGTCCTGAGCGTCGTTCTGGACGGCACTGCGCAGAGGTCGTATCTGCTGTGCCTGGACGCGAGGACGATGGAG
GAGACGGGGAGAGCCGAGGCCGACTTCCCCATCGCGCTCGGGTTCCATGGATTCCACGCGCCCGTCGTGACTTGA
Gene >Hirsu2|5391
ATGGCGGTCAACGCATCCGGCGTTCTCCACCGCACCGCCCAGAACGAGGTCCAAGACAAAGAACAGTCGTTTCGC
AACGTCGAAGACGAGTCGTGGAAAGACTGGCCCAACCATGCCGGCGTAAGTTCAGGCCCGCCCACGCGCGCTCAC
TCCGTGCCGGCAGCCGTCCTTTGAAGTGGTCTCGGCCTTGCCATGCATACGCCTACTGACGGCATGTCCCCACAC
GAAGTTTGAGGGCCTCGAGGAACACCGAGGTCCGCTGAAGCTTCGCGTTAAGGGCTCCATCCCGGCCTGGGCTGC
GGGCTCGCTATACCGAACAGGCCCCGGCCAGAGCAGCGTCGAGGACACGTCCCGCGGGACGCACTACGTATCGCA
CTGGTTTGACGGCTTTGCCCACACCCACAAGTTCGACATCGTGGCCCCGGGCGAGGACGGCGAGGAGACGGCCGT
CATCTACTCGTCGCGGCGGCAGTCCGAAGACCACGTCGCCCAGATCAAGAAGACGGGCTGGCGCTCAAGCACCTC
GTTTGGACAAAAAGCCGACCCCTGCATCGGCATCTTCGCCAAATTCATGAGTTTTTTTGTGCCGCGCCGGCTGAA
CAACAATGTCGCCTGCCTGCCCAACTTCCCTGGCCTGCAGGACAACGGGCCGGTGAGCAACCAGAGCGGCCATCG
GACGGGGACGAGCAACATCTACATCAGCACAGACCACTGCGCCTTGCAGGAAATAAGCCCGGACACCCTGGAGCC
CCTAGGATTCGTGAACCAGCAGCGCCTTCACCCGGACCTCGACGGCGTCTTGTCCTGCGCACACGCCCAGCGGGA
CCACGAGACGGGAGATTGGTTCAACTTCAACCTGGCCCTGGGCCGCCAGGCAACGTACCGCGTGTTTCGCGTAAA
CGCAATCCTTGGCACCACCGACCTCCTCGCCACCATCTCGGAGCCTGACTTGGCGGCCGCGTACATGCACAGCTT
CTTCCTGACGGAGAACTATGTCGTGCTCTGCATCCCGTCCAGCCACTTCGGATGGAAAGGGCTCAAGATCATGTG
GGAGAAGAACCTGCTGGATGCCATCAAGCCCTTTGACGAGAAGCGGCGGTGCCAGTGGGTGGTCGTGGACCGAAA
GAACGACCAGGGCGTGGTCGCGCGCTTCTCGACGCCCGCCGGCTTCTTCTTCCACTCGGTCAACGCGTTCGAGGA
GCTCACTAAGGACGAGACTGGCTCGAAGCGAGTGGACCTGTGCCTGGACCACACCATGTACGACAACACGGACAT
CATGTTCGGCCTCTACTACGATGTCATTCTGGACCGCAAAGATGCCATGAGGGAGTTTGTCGCGAGCGGACGGCA
CAAGACGTGGCAAAGTCGCCATGTGCGGTACCGCTTCAGGATGCCCGTGTCGGGGCAGACGCGAGAGGAGGCCCG
AGCGGCGACGGCCGAGCAGGTCTTTTCGATTGCCAGCCCACATTCGGGGGAGCTGTCGACGATCCACCCCGGGCG
GACGGGGCGGTCCTACCGATACGTATACGGGACGAGCAACCGCGGGCTCAGCACTTTCATGGACGCGATCGTCAA
GACAGATTTGGACACACACGATGCAGTCCTGTGGAGCGGTCCGCAGGCGCACACGCCGGGCGAGCCCGTCTTTGT
GCCACGGCCCGGTGGAACAGACGAGGACGATGGGGTCGTCCTGAGCGTCGTTCTGGACGGCACTGCGCAGAGGTC
GTATCTGCTGTGCCTGGACGCGAGGACGATGGAGGAGACGGGGAGAGCCGAGGCCGACTTCCCCATCGCGCTCGG
GTTCCATGGATTCCACGCGCCCGTCGTGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail