Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|5388
Gene name
LocationContig_27:15809..16592
Strand-
Gene length (bp)783
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00190 Cupin_1 Cupin 4.5E-20 76 206

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P09350|SR1A_PHYPO Spherulin-1A OS=Physarum polycephalum PE=1 SV=1 40 247 4.0E-55
sp|P09351|SR1B_PHYPO Spherulin-1B OS=Physarum polycephalum PE=2 SV=1 42 247 2.0E-51
sp|Q7XZY1|GL32_ORYSJ Putative germin-like protein 3-2 OS=Oryza sativa subsp. japonica GN=Os03g0651800 PE=3 SV=1 69 231 7.0E-19
sp|Q9LEA7|GL18_ARATH Germin-like protein subfamily 1 member 8 OS=Arabidopsis thaliana GN=GLP9 PE=2 SV=2 72 229 3.0E-16
sp|Q6K5P9|GL22_ORYSJ Putative germin-like protein 2-2 OS=Oryza sativa subsp. japonica GN=Os02g0491700 PE=3 SV=1 68 207 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P09350|SR1A_PHYPO Spherulin-1A OS=Physarum polycephalum PE=1 SV=1 40 247 4.0E-55
sp|P09351|SR1B_PHYPO Spherulin-1B OS=Physarum polycephalum PE=2 SV=1 42 247 2.0E-51
sp|Q7XZY1|GL32_ORYSJ Putative germin-like protein 3-2 OS=Oryza sativa subsp. japonica GN=Os03g0651800 PE=3 SV=1 69 231 7.0E-19
sp|Q9LEA7|GL18_ARATH Germin-like protein subfamily 1 member 8 OS=Arabidopsis thaliana GN=GLP9 PE=2 SV=2 72 229 3.0E-16
sp|Q6K5P9|GL22_ORYSJ Putative germin-like protein 2-2 OS=Oryza sativa subsp. japonica GN=Os02g0491700 PE=3 SV=1 68 207 1.0E-14
sp|Q6YZA9|GL82_ORYSJ Germin-like protein 8-2 OS=Oryza sativa subsp. japonica GN=GER3 PE=2 SV=1 60 207 4.0E-14
sp|Q6I544|GL52_ORYSJ Germin-like protein 5-1 OS=Oryza sativa subsp. japonica GN=Os05g0277500 PE=2 SV=1 72 230 5.0E-14
sp|Q2QXJ0|GL124_ORYSJ Putative germin-like protein 12-4 OS=Oryza sativa subsp. japonica GN=Os12g0155000 PE=3 SV=2 76 213 5.0E-14
sp|Q942A8|GL13_ORYSJ Germin-like protein 1-3 OS=Oryza sativa subsp. japonica GN=GER8 PE=2 SV=1 69 228 7.0E-14
sp|Q2QXJ4|GL121_ORYSJ Germin-like protein 12-1 OS=Oryza sativa subsp. japonica GN=Os12g0154700 PE=2 SV=1 76 227 1.0E-13
sp|O65252|GL25_ARATH Probable germin-like protein subfamily 2 member 5 OS=Arabidopsis thaliana GN=At5g26700 PE=2 SV=2 72 210 2.0E-13
sp|Q6YZA6|GL85_ORYSJ Germin-like protein 8-5 OS=Oryza sativa subsp. japonica GN=Os08g0189400 PE=2 SV=1 68 213 2.0E-13
sp|Q6K5Q0|GL21_ORYSJ Putative germin-like protein 2-1 OS=Oryza sativa subsp. japonica GN=Os02g0491600 PE=3 SV=1 72 205 2.0E-13
sp|P45852|GLP1_MESCR Germin-like protein OS=Mesembryanthemum crystallinum PE=2 SV=1 67 207 2.0E-13
sp|Q2QXJ2|GL122_ORYSJ Germin-like protein 12-2 OS=Oryza sativa subsp. japonica GN=Os12g0154800 PE=2 SV=1 76 201 4.0E-13
sp|Q9M263|GL24_ARATH Germin-like protein subfamily 2 member 4 OS=Arabidopsis thaliana GN=GLP10 PE=2 SV=1 114 228 6.0E-13
sp|Q6K5P8|GL23_ORYSJ Putative germin-like protein 2-3 OS=Oryza sativa subsp. japonica GN=Os02g0491800 PE=3 SV=1 72 212 1.0E-12
sp|Q9SPV5|NEC1_NICPL Nectarin-1 OS=Nicotiana plumbaginifolia GN=NEC1 PE=1 SV=1 73 228 1.0E-12
sp|Q7XSN6|GL41_ORYSJ Germin-like protein 4-1 OS=Oryza sativa subsp. japonica GN=Os04g0617900 PE=2 SV=2 77 227 2.0E-12
sp|Q6YZA1|GL88_ORYSJ Germin-like protein 8-8 OS=Oryza sativa subsp. japonica GN=Os08g0189700 PE=2 SV=1 68 213 2.0E-12
sp|Q6YZ97|GL810_ORYSJ Germin-like protein 8-10 OS=Oryza sativa subsp. japonica GN=GLP2 PE=2 SV=1 46 213 3.0E-12
sp|Q9S8P4|RHRE_PEA Rhicadhesin receptor OS=Pisum sativum GN=GER1 PE=1 SV=2 72 228 3.0E-12
sp|Q94EG3|NEC1_NICLS Nectarin-1 OS=Nicotiana langsdorffii x Nicotiana sanderae GN=NECI PE=1 SV=1 73 228 4.0E-12
sp|Q6YZ99|GL89_ORYSJ Germin-like protein 8-9 OS=Oryza sativa subsp. japonica GN=Os08g0189850 PE=2 SV=1 68 213 4.0E-12
sp|P93000|GL23_ARATH Germin-like protein subfamily 2 member 3 OS=Arabidopsis thaliana GN=GLP8 PE=2 SV=1 88 231 5.0E-12
sp|P92998|GL11_ARATH Germin-like protein subfamily 1 member 1 OS=Arabidopsis thaliana GN=GLP7 PE=2 SV=2 47 230 5.0E-12
sp|Q2QXJ1|GL123_ORYSJ Putative germin-like protein 12-3 OS=Oryza sativa subsp. japonica GN=Os12g0154900 PE=3 SV=1 76 227 6.0E-12
sp|Q6YZY5|GL811_ORYSJ Germin-like protein 8-11 OS=Oryza sativa subsp. japonica GN=Os08g0190100 PE=1 SV=1 65 213 6.0E-12
sp|Q6YZA4|GL86_ORYSJ Germin-like protein 8-6 OS=Oryza sativa subsp. japonica GN=Os08g0189500 PE=2 SV=1 68 213 7.0E-12
sp|Q6YZZ2|GL87_ORYSJ Germin-like protein 8-7 OS=Oryza sativa subsp. japonica GN=GER6 PE=2 SV=1 68 207 8.0E-12
sp|Q6YZZ6|GL84_ORYSJ Germin-like protein 8-4 OS=Oryza sativa subsp. japonica GN=GER1 PE=2 SV=1 114 228 1.0E-11
sp|Q6YZB2|GL81_ORYSJ Putative germin-like protein 8-1 OS=Oryza sativa subsp. japonica GN=Os08g0188900 PE=3 SV=1 4 224 3.0E-11
sp|Q6YZZ7|GL83_ORYSJ Germin-like protein 8-3 OS=Oryza sativa subsp. japonica GN=GER2 PE=2 SV=1 114 233 4.0E-11
sp|Q9FZ27|GL22_ARATH Germin-like protein subfamily 2 member 2 OS=Arabidopsis thaliana GN=At1g02335 PE=2 SV=1 72 212 5.0E-11
sp|Q9SR72|GL32_ARATH Germin-like protein subfamily 3 member 2 OS=Arabidopsis thaliana GN=At3g10080 PE=2 SV=1 69 201 5.0E-11
sp|Q6ZCR3|GL812_ORYSJ Germin-like protein 8-12 OS=Oryza sativa subsp. japonica GN=Os08g0231400 PE=2 SV=1 114 233 5.0E-11
sp|Q9FMA8|GL111_ARATH Germin-like protein subfamily 1 member 11 OS=Arabidopsis thaliana GN=At5g38940 PE=2 SV=1 118 219 5.0E-11
sp|P94014|GL21_ARATH Germin-like protein subfamily 2 member 1 OS=Arabidopsis thaliana GN=GLP4 PE=2 SV=2 77 207 9.0E-11
sp|Q9FMB0|GL19_ARATH Putative germin-like protein subfamily 1 member 9 OS=Arabidopsis thaliana GN=At5g38910 PE=3 SV=1 88 207 1.0E-10
sp|Q851K0|GL35_ORYSJ Germin-like protein 3-5 OS=Oryza sativa subsp. japonica GN=Os03g0693900 PE=2 SV=1 114 212 2.0E-10
sp|Q851K1|GL36_ORYSJ Germin-like protein 3-6 OS=Oryza sativa subsp. japonica GN=Os03g0694000 PE=2 SV=1 114 212 2.0E-10
sp|Q851J8|GL33_ORYSJ Germin-like protein 3-3 OS=Oryza sativa subsp. japonica GN=Os03g0693700 PE=2 SV=1 116 212 2.0E-10
sp|Q851J9|GL34_ORYSJ Putative germin-like protein 3-4 OS=Oryza sativa subsp. japonica GN=Os03g0693800 PE=3 SV=1 114 212 3.0E-10
sp|Q942A7|GL14_ORYSJ Germin-like protein 1-4 OS=Oryza sativa subsp. japonica GN=Os01g0952100 PE=1 SV=1 72 228 3.0E-10
sp|P45850|OXO1_HORVU Oxalate oxidase 1 OS=Hordeum vulgare PE=1 SV=1 69 212 4.0E-10
sp|P15290|GER2_WHEAT Oxalate oxidase GF-2.8 OS=Triticum aestivum PE=1 SV=1 114 232 4.0E-10
sp|P45851|OXO2_HORVU Oxalate oxidase 2 OS=Hordeum vulgare PE=2 SV=1 114 212 7.0E-10
sp|Q9M8X6|GL16_ARATH Germin-like protein subfamily 1 member 6 OS=Arabidopsis thaliana GN=At3g04200 PE=2 SV=1 118 207 7.0E-10
sp|P92995|GLT1_ARATH Germin-like protein subfamily T member 1 OS=Arabidopsis thaliana GN=GLP1 PE=2 SV=2 84 212 1.0E-09
sp|Q75HJ4|GL38_ORYSJ Germin-like protein 3-8 OS=Oryza sativa subsp. japonica GN=Os03g0804700 PE=2 SV=1 88 228 2.0E-09
sp|Q8H021|GL31_ORYSJ Germin-like protein 3-1 OS=Oryza sativa subsp. japonica GN=Os03g0179000 PE=3 SV=1 74 230 2.0E-09
sp|Q6ESF0|GL24_ORYSJ Germin-like protein 2-4 OS=Oryza sativa subsp. japonica GN=Os02g0532500 PE=2 SV=1 68 213 2.0E-09
sp|Q9SFF9|GL17_ARATH Germin-like protein subfamily 1 member 7 OS=Arabidopsis thaliana GN=At3g05950 PE=2 SV=1 114 212 2.0E-09
sp|Q6ZBZ2|GL814_ORYSJ Germin-like protein 8-14 OS=Oryza sativa subsp. japonica GN=GER5 PE=1 SV=1 123 230 3.0E-09
sp|Q9FMA9|GL110_ARATH Germin-like protein subfamily 1 member 10 OS=Arabidopsis thaliana GN=At5g38930 PE=3 SV=1 118 207 3.0E-09
sp|Q9LMC9|GLT2_ARATH Germin-like protein subfamily T member 2 OS=Arabidopsis thaliana GN=At1g18980 PE=2 SV=1 72 223 4.0E-09
sp|Q10BU2|GL37_ORYSJ Germin-like protein 3-7 OS=Oryza sativa subsp. japonica GN=GER7 PE=2 SV=1 72 228 5.0E-09
sp|Q9FIC8|GL116_ARATH Germin-like protein subfamily 1 member 16 OS=Arabidopsis thaliana GN=At5g39130 PE=2 SV=1 72 227 5.0E-09
sp|P92996|GL120_ARATH Germin-like protein subfamily 1 member 20 OS=Arabidopsis thaliana GN=GLP5A PE=1 SV=1 72 227 6.0E-09
sp|P92999|GL118_ARATH Germin-like protein subfamily 1 member 18 OS=Arabidopsis thaliana GN=GLP2A PE=2 SV=2 72 227 7.0E-09
sp|Q6Z964|GL813_ORYSJ Germin-like protein 8-13 OS=Oryza sativa subsp. japonica GN=Os08g0459700 PE=3 SV=1 73 202 7.0E-09
sp|Q94JF3|GL12_ORYSJ Germin-like protein 1-2 OS=Oryza sativa subsp. japonica GN=Os01g0705100 PE=3 SV=1 88 205 8.0E-09
sp|L8BRS3|GLP1_MORAL Germin-like protein OS=Morus alba PE=1 SV=1 72 201 8.0E-09
sp|O04012|AB19B_PRUPE Auxin-binding protein ABP19b OS=Prunus persica GN=ABP19B PE=3 SV=1 69 230 1.0E-08
sp|P94040|GL31_ARATH Germin-like protein subfamily 3 member 1 OS=Arabidopsis thaliana GN=GLP1 PE=1 SV=1 72 202 2.0E-08
sp|P46271|GLP1_BRANA Germin-like protein 1 OS=Brassica napus GN=GER1 PE=2 SV=1 69 220 2.0E-08
sp|Q9FMA6|GL112_ARATH Putative germin-like protein subfamily 1 member 12 OS=Arabidopsis thaliana GN=At5g38960 PE=3 SV=1 118 207 2.0E-08
sp|Q7F731|GL11_ORYSJ Germin-like protein 1-1 OS=Oryza sativa subsp. japonica GN=GER4 PE=2 SV=1 72 212 2.0E-08
sp|Q652Q1|GL91_ORYSJ Germin-like protein 9-1 OS=Oryza sativa subsp. japonica GN=Os09g0568500 PE=2 SV=1 94 201 2.0E-08
sp|P26759|GER3_WHEAT Oxalate oxidase GF-3.8 OS=Triticum aestivum PE=1 SV=1 116 207 3.0E-08
sp|P92997|GL113_ARATH Germin-like protein subfamily 1 member 13 OS=Arabidopsis thaliana GN=GLP6 PE=2 SV=2 72 228 4.0E-08
sp|Q9FIC6|GL117_ARATH Germin-like protein subfamily 1 member 17 OS=Arabidopsis thaliana GN=At5g39150 PE=2 SV=1 115 209 4.0E-08
sp|Q9ZRA4|AB19A_PRUPE Auxin-binding protein ABP19a OS=Prunus persica GN=ABP19A PE=3 SV=1 69 230 4.0E-08
sp|Q9FIC9|GL115_ARATH Germin-like protein subfamily 1 member 15 OS=Arabidopsis thaliana GN=At5g39120 PE=2 SV=1 115 209 4.0E-08
sp|Q9FID0|GL114_ARATH Germin-like protein subfamily 1 member 14 OS=Arabidopsis thaliana GN=At5g39110 PE=3 SV=1 115 209 5.0E-08
sp|Q9FL89|GL119_ARATH Germin-like protein subfamily 1 member 19 OS=Arabidopsis thaliana GN=At5g39180 PE=2 SV=1 115 209 1.0E-07
sp|Q9M8X5|GL15_ARATH Germin-like protein subfamily 1 member 5 OS=Arabidopsis thaliana GN=At3g04190 PE=2 SV=1 72 227 1.0E-07
sp|Q652P9|GL93_ORYSJ Germin-like protein 9-3 OS=Oryza sativa subsp. japonica GN=Os09g0568700 PE=2 SV=1 94 201 2.0E-07
sp|Q9M8X4|GL14_ARATH Germin-like protein subfamily 1 member 4 OS=Arabidopsis thaliana GN=At3g04180 PE=3 SV=1 72 227 3.0E-07
sp|Q652Q0|GL92_ORYSJ Putative germin-like protein 9-2 OS=Oryza sativa subsp. japonica GN=Os09g0568600 PE=3 SV=1 94 186 4.0E-07
sp|P45854|GLP1_SINAL Germin-like protein 1 OS=Sinapis alba GN=GLP1 PE=2 SV=1 86 211 4.0E-07
sp|P94072|GL33_ARATH Germin-like protein subfamily 3 member 3 OS=Arabidopsis thaliana GN=GER3 PE=1 SV=1 75 211 5.0E-07
sp|Q688L5|GL51_ORYSJ Germin-like protein 5-1 OS=Oryza sativa subsp. japonica GN=Os05g0197200 PE=2 SV=1 94 212 9.0E-07
sp|Q9M8X1|GL12_ARATH Putative germin-like protein subfamily 1 member 2 OS=Arabidopsis thaliana GN=At3g04150 PE=2 SV=1 72 205 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|5388
MHFSRVSFTLLLAGVGIAAPSSEPGADIDDALPPVVPVNTRSGNDDLIARLMTAPTQADRVRLLDQPGDFVFDFN
NMTTPGARTQGRGGSTIAATSRTMPALIGNGEAVTLGFLGPCGMNTPHVHNRATELNVVAQGRLVTNFIVENGAR
VIANTLSRFQMAVFPQGAIHQEFNPDCEEAVFVAAFNDPDPGVQTIAQNFFSLRPDVVSATLGGVQTLNGQDIES
FRNMIPANVALGIEACLKKCGIKRNEKRSFEEVLV*
Coding >Hirsu2|5388
ATGCATTTCTCTCGAGTCTCTTTTACCCTGCTCCTTGCGGGGGTCGGCATCGCCGCCCCTTCCTCGGAGCCGGGC
GCCGACATCGATGACGCTCTCCCGCCCGTCGTGCCCGTAAACACGCGGTCCGGCAATGACGACCTTATCGCCAGG
CTCATGACAGCTCCGACTCAGGCCGACCGCGTCAGGCTGCTCGACCAACCCGGCGACTTCGTCTTCGACTTCAAT
AACATGACCACCCCGGGCGCCAGGACACAGGGGAGGGGCGGCTCTACCATCGCCGCCACGTCCCGGACCATGCCG
GCCCTTATCGGCAACGGCGAGGCCGTAACACTCGGTTTCCTCGGCCCTTGCGGAATGAATACGCCGCACGTACAT
AACCGTGCAACCGAACTAAATGTCGTCGCCCAAGGCCGCCTCGTAACCAACTTTATAGTCGAGAACGGCGCGCGG
GTAATCGCGAATACGCTCTCGCGCTTCCAGATGGCTGTGTTCCCCCAAGGCGCTATCCATCAGGAATTTAACCCG
GATTGCGAAGAGGCTGTATTCGTCGCGGCCTTTAATGACCCGGATCCGGGTGTTCAGACGATTGCACAGAACTTC
TTTAGCTTACGGCCGGACGTCGTGAGTGCGACTCTTGGGGGCGTGCAGACTCTTAACGGACAAGATATCGAGTCG
TTCCGGAACATGATTCCTGCCAACGTCGCCTTAGGCATCGAGGCCTGCTTGAAAAAGTGCGGGATTAAGCGCAAT
GAGAAGAGGAGCTTCGAGGAGGTGCTTGTCTAG
Transcript >Hirsu2|5388
ATGCATTTCTCTCGAGTCTCTTTTACCCTGCTCCTTGCGGGGGTCGGCATCGCCGCCCCTTCCTCGGAGCCGGGC
GCCGACATCGATGACGCTCTCCCGCCCGTCGTGCCCGTAAACACGCGGTCCGGCAATGACGACCTTATCGCCAGG
CTCATGACAGCTCCGACTCAGGCCGACCGCGTCAGGCTGCTCGACCAACCCGGCGACTTCGTCTTCGACTTCAAT
AACATGACCACCCCGGGCGCCAGGACACAGGGGAGGGGCGGCTCTACCATCGCCGCCACGTCCCGGACCATGCCG
GCCCTTATCGGCAACGGCGAGGCCGTAACACTCGGTTTCCTCGGCCCTTGCGGAATGAATACGCCGCACGTACAT
AACCGTGCAACCGAACTAAATGTCGTCGCCCAAGGCCGCCTCGTAACCAACTTTATAGTCGAGAACGGCGCGCGG
GTAATCGCGAATACGCTCTCGCGCTTCCAGATGGCTGTGTTCCCCCAAGGCGCTATCCATCAGGAATTTAACCCG
GATTGCGAAGAGGCTGTATTCGTCGCGGCCTTTAATGACCCGGATCCGGGTGTTCAGACGATTGCACAGAACTTC
TTTAGCTTACGGCCGGACGTCGTGAGTGCGACTCTTGGGGGCGTGCAGACTCTTAACGGACAAGATATCGAGTCG
TTCCGGAACATGATTCCTGCCAACGTCGCCTTAGGCATCGAGGCCTGCTTGAAAAAGTGCGGGATTAAGCGCAAT
GAGAAGAGGAGCTTCGAGGAGGTGCTTGTCTAG
Gene >Hirsu2|5388
ATGCATTTCTCTCGAGTCTCTTTTACCCTGCTCCTTGCGGGGGTCGGCATCGCCGCCCCTTCCTCGGAGCCGGGC
GCCGACATCGATGACGCTCTCCCGCCCGTCGTGCCCGTAAACACGCGGTCCGGCAATGACGACCTTATCGCCAGG
CTCATGACAGCTCCGACTCAGGCCGACCGCGTCAGGCTGCTCGACCAACCCGGCGACTTCGTCTTCGACTTCAAT
AACATGACCACCCCGGGCGCCAGGACACAGGGGAGGGGCGGCTCTACCATCGCCGCCACGTCCCGGACCATGCCG
GCCCTTATCGGCAACGGCGAGGCCGTAACACTCGGTTTCCTCGGCCCTTGCGGAATGAATACGCCGCACGTACAT
AACCGTGCAACCGAACTAAATGTCGTCGCCCAAGGCCGCCTCGTAACCAACTTTATAGTCGAGAACGGCGCGCGG
GTAATCGCGAATACGCTCTCGCGCTTCCAGATGGCTGTGTTCCCCCAAGGCGCTATCCATCAGGAATTTAACCCG
GATTGCGAAGAGGCTGTATTCGTCGCGGCCTTTAATGACCCGGATCCGGGTGTTCAGACGATTGCACAGAACTTC
TTTAGCTTACGGCCGGACGTCGTGAGTGCGACTCTTGGGGGCGTGCAGACTCTTAACGGACAAGATATCGAGTCG
TTCCGGAACATGATTCCTGCCAACGTCGCCTTAGGCATCGAGGCCTGCTTGAAAAAGTGCGGGATTAAGCGCAAT
GAGAAGAGGAGCTTCGAGGAGGTGCTTGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail