© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|5368 |
| Gene name | |
| Location | Contig_2689:690..1976 |
| Strand | + |
| Gene length (bp) | 1286 |
| Transcript length (bp) | 996 |
| Coding sequence length (bp) | 996 |
| Protein length (aa) | 332 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00501 | AMP-binding | AMP-binding enzyme | 2.1E-41 | 50 | 318 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q8H151|AAE13_ARATH | Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 | 66 | 314 | 4.0E-38 |
| sp|Q3URE1|ACSF3_MOUSE | Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 | 92 | 314 | 3.0E-34 |
| sp|Q4G176|ACSF3_HUMAN | Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 | 92 | 321 | 5.0E-32 |
| sp|Q6GLK6|ACSF3_XENLA | Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 | 99 | 314 | 7.0E-32 |
| sp|Q58DN7|ACSF3_BOVIN | Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 | 88 | 314 | 5.0E-28 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q8H151|AAE13_ARATH | Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 | 66 | 314 | 4.0E-38 |
| sp|Q3URE1|ACSF3_MOUSE | Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 | 92 | 314 | 3.0E-34 |
| sp|Q4G176|ACSF3_HUMAN | Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 | 92 | 321 | 5.0E-32 |
| sp|Q6GLK6|ACSF3_XENLA | Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 | 99 | 314 | 7.0E-32 |
| sp|Q58DN7|ACSF3_BOVIN | Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 | 88 | 314 | 5.0E-28 |
| sp|Q0K844|SAUT_CUPNH | Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 | 46 | 320 | 4.0E-20 |
| sp|Q9SMT7|4CLLA_ARATH | Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 | 46 | 321 | 1.0E-16 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 99 | 323 | 9.0E-16 |
| sp|Q08787|SRFAC_BACSU | Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 | 54 | 243 | 9.0E-16 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 99 | 323 | 1.0E-15 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 46 | 326 | 1.0E-15 |
| sp|O74976|FAT2_SCHPO | Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 | 83 | 313 | 1.0E-15 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 99 | 266 | 2.0E-15 |
| sp|O07610|LCFB_BACSU | Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 | 47 | 312 | 8.0E-15 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 85 | 271 | 1.0E-14 |
| sp|Q8GB18|CAIC_PROSL | Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 | 67 | 281 | 3.0E-14 |
| sp|B4EY25|CAIC_PROMH | Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 | 67 | 281 | 3.0E-14 |
| sp|Q9S777|4CL3_ARATH | 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 | 56 | 313 | 2.0E-13 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 96 | 305 | 2.0E-13 |
| sp|P45745|DHBF_BACSU | Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 | 99 | 266 | 4.0E-13 |
| sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 46 | 221 | 6.0E-13 |
| sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 56 | 266 | 1.0E-12 |
| sp|P39846|PPSB_BACSU | Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 | 96 | 324 | 1.0E-12 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 99 | 266 | 5.0E-12 |
| sp|Q65FT5|MENE_BACLD | 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 | 47 | 310 | 7.0E-12 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 51 | 266 | 7.0E-12 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 85 | 266 | 7.0E-12 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 98 | 266 | 8.0E-12 |
| sp|Q0VZ70|CHSAD_CHOCO | Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 | 99 | 266 | 1.0E-11 |
| sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 67 | 221 | 2.0E-11 |
| sp|B9J2F2|MENE_BACCQ | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 | 96 | 281 | 2.0E-11 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 45 | 218 | 3.0E-11 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 45 | 218 | 3.0E-11 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 99 | 266 | 4.0E-11 |
| sp|B7UI83|CAIC_ECO27 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 | 96 | 278 | 4.0E-11 |
| sp|P40806|PKSJ_BACSU | Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 | 97 | 264 | 4.0E-11 |
| sp|O31782|PKSN_BACSU | Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 | 51 | 221 | 4.0E-11 |
| sp|P39847|PPSC_BACSU | Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 | 28 | 238 | 5.0E-11 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 46 | 266 | 7.0E-11 |
| sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 99 | 329 | 8.0E-11 |
| sp|B5BL55|CAIC_SALPK | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 | 67 | 278 | 8.0E-11 |
| sp|Q5PIL0|CAIC_SALPA | Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 | 67 | 278 | 8.0E-11 |
| sp|B7JDD6|MENE_BACC0 | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 | 96 | 320 | 1.0E-10 |
| sp|Q9R9J1|MYCA_BACIU | Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 | 51 | 266 | 2.0E-10 |
| sp|Q816I1|MENE_BACCR | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 | 96 | 281 | 2.0E-10 |
| sp|C3LB87|MENE_BACAC | 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 | 96 | 327 | 3.0E-10 |
| sp|C3PCK3|MENE_BACAA | 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 | 96 | 327 | 3.0E-10 |
| sp|Q81K97|MENE_BACAN | 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 | 96 | 327 | 3.0E-10 |
| sp|Q6HC29|MENE_BACHK | 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 | 96 | 320 | 3.0E-10 |
| sp|A0RK73|MENE_BACAH | 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 | 96 | 320 | 3.0E-10 |
| sp|P39845|PPSA_BACSU | Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 | 65 | 218 | 3.0E-10 |
| sp|Q632I5|MENE_BACCZ | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 | 39 | 277 | 4.0E-10 |
| sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 46 | 218 | 6.0E-10 |
| sp|P38137|FAT2_YEAST | Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 | 98 | 324 | 6.0E-10 |
| sp|B7HTW3|MENE_BACC7 | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 | 39 | 281 | 7.0E-10 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 96 | 266 | 7.0E-10 |
| sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 99 | 232 | 7.0E-10 |
| sp|Q72YK9|MENE_BACC1 | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 | 96 | 281 | 8.0E-10 |
| sp|P9WQ37|FAC13_MYCTU | Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 | 96 | 329 | 8.0E-10 |
| sp|P9WQ36|FAC13_MYCTO | Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 | 96 | 329 | 8.0E-10 |
| sp|Q8FLA5|CAIC_ECOL6 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 | 96 | 278 | 1.0E-09 |
| sp|Q0TLV2|CAIC_ECOL5 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 | 96 | 278 | 1.0E-09 |
| sp|P86832|CBCL2_ARTSP | 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 | 51 | 260 | 1.0E-09 |
| sp|P86831|CBCL1_ARTSP | 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 | 51 | 260 | 1.0E-09 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 99 | 233 | 2.0E-09 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 99 | 233 | 2.0E-09 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 46 | 221 | 2.0E-09 |
| sp|P09095|TYCA_BREPA | Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 | 99 | 330 | 2.0E-09 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 99 | 242 | 2.0E-09 |
| sp|A8ALR6|CAIC_CITK8 | Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 | 96 | 278 | 2.0E-09 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 99 | 221 | 2.0E-09 |
| sp|Q70LM7|LGRA_BREPA | Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 | 10 | 269 | 2.0E-09 |
| sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 51 | 222 | 3.0E-09 |
| sp|Q6D107|AAS_PECAS | Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 | 198 | 271 | 3.0E-09 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 99 | 266 | 4.0E-09 |
| sp|Q74RZ6|AAS_YERPE | Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 | 195 | 271 | 4.0E-09 |
| sp|Q1CAS8|AAS_YERPA | Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 | 195 | 271 | 4.0E-09 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 46 | 312 | 4.0E-09 |
| sp|P39845|PPSA_BACSU | Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 | 41 | 233 | 5.0E-09 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 46 | 270 | 5.0E-09 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 99 | 266 | 5.0E-09 |
| sp|B7LWM8|CAIC_ESCF3 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 | 96 | 278 | 5.0E-09 |
| sp|P31687|4CL2_SOYBN | 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 | 86 | 273 | 5.0E-09 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 55 | 266 | 6.0E-09 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 51 | 328 | 6.0E-09 |
| sp|A9VM74|MENE_BACWK | 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 | 97 | 320 | 6.0E-09 |
| sp|Q83MG9|CAIC_SHIFL | Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 | 96 | 278 | 6.0E-09 |
| sp|Q0T8F7|CAIC_SHIF8 | Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 | 96 | 278 | 6.0E-09 |
| sp|A1JPF0|AAS_YERE8 | Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 | 195 | 271 | 6.0E-09 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 85 | 216 | 7.0E-09 |
| sp|A4TLD3|AAS_YERPP | Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 | 195 | 271 | 7.0E-09 |
| sp|A9R2S1|AAS_YERPG | Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 | 195 | 271 | 7.0E-09 |
| sp|B1JQC1|AAS_YERPY | Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 | 195 | 271 | 8.0E-09 |
| sp|Q667F1|AAS_YERPS | Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 | 195 | 271 | 8.0E-09 |
| sp|B2JZ75|AAS_YERPB | Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 | 195 | 271 | 8.0E-09 |
| sp|A7FFD1|AAS_YERP3 | Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 | 195 | 271 | 8.0E-09 |
| sp|C6DE43|AAS_PECCP | Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 | 198 | 271 | 8.0E-09 |
| sp|P0C062|GRSA_BREBE | Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 | 99 | 222 | 9.0E-09 |
| sp|P0C061|GRSA_ANEMI | Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 | 99 | 222 | 9.0E-09 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 96 | 222 | 1.0E-08 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 5 | 232 | 1.0E-08 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 96 | 221 | 1.0E-08 |
| sp|B7MAG0|CAIC_ECO45 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 | 96 | 278 | 1.0E-08 |
| sp|B2VFS7|AAS_ERWT9 | Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 | 198 | 271 | 1.0E-08 |
| sp|Q1RGG1|CAIC_ECOUT | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 | 96 | 278 | 1.0E-08 |
| sp|A1A787|CAIC_ECOK1 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 | 96 | 278 | 1.0E-08 |
| sp|C8VTR6|Y0074_EMENI | Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 | 113 | 313 | 1.0E-08 |
| sp|B7N7R2|CAIC_ECOLU | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 | 96 | 278 | 1.0E-08 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 46 | 221 | 2.0E-08 |
| sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 46 | 239 | 2.0E-08 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 99 | 223 | 2.0E-08 |
| sp|P38135|FADK_ECOLI | Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 | 55 | 288 | 2.0E-08 |
| sp|Q91VE0|S27A4_MOUSE | Long-chain fatty acid transport protein 4 OS=Mus musculus GN=Slc27a4 PE=1 SV=1 | 33 | 278 | 2.0E-08 |
| sp|A8AP56|AAS_CITK8 | Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 | 196 | 271 | 2.0E-08 |
| sp|B1IRD9|CAIC_ECOLC | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 | 96 | 278 | 2.0E-08 |
| sp|P31552|CAIC_ECOLI | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 | 96 | 278 | 2.0E-08 |
| sp|B1XBG2|CAIC_ECODH | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 | 96 | 278 | 2.0E-08 |
| sp|C4ZPW3|CAIC_ECOBW | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 | 96 | 278 | 2.0E-08 |
| sp|B5XUP2|AAS_KLEP3 | Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 | 198 | 271 | 2.0E-08 |
| sp|B7MNP4|CAIC_ECO81 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 | 96 | 278 | 2.0E-08 |
| sp|Q7WSH3|FADD3_COMTE | 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 | 65 | 303 | 2.0E-08 |
| sp|P14912|4CL1_PETCR | 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 | 56 | 273 | 2.0E-08 |
| sp|A7ZHC8|CAIC_ECO24 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 | 96 | 278 | 2.0E-08 |
| sp|B6HYY8|CAIC_ECOSE | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 | 96 | 278 | 3.0E-08 |
| sp|B7L4G0|CAIC_ECO55 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 | 96 | 278 | 3.0E-08 |
| sp|B7M0D4|CAIC_ECO8A | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 | 96 | 278 | 3.0E-08 |
| sp|Q84P23|4CLL9_ARATH | 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 | 60 | 279 | 3.0E-08 |
| sp|Q3Z5X2|CAIC_SHISS | Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 | 96 | 278 | 3.0E-08 |
| sp|A7ZVY7|CAIC_ECOHS | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 | 96 | 278 | 3.0E-08 |
| sp|Q6ZAC1|4CL5_ORYSJ | Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 | 96 | 273 | 3.0E-08 |
| sp|B7NHE1|CAIC_ECO7I | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 | 96 | 278 | 3.0E-08 |
| sp|B1LFX0|CAIC_ECOSM | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 | 96 | 278 | 3.0E-08 |
| sp|A6TDH2|AAS_KLEP7 | Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 | 198 | 271 | 3.0E-08 |
| sp|B5YYD1|CAIC_ECO5E | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 | 96 | 278 | 3.0E-08 |
| sp|Q8XA34|CAIC_ECO57 | Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 | 96 | 278 | 3.0E-08 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 99 | 221 | 4.0E-08 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 96 | 266 | 5.0E-08 |
| sp|Q32K60|CAIC_SHIDS | Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 | 96 | 278 | 5.0E-08 |
| sp|Q7N7A9|AAS_PHOLL | Bifunctional protein Aas OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aas PE=3 SV=1 | 63 | 271 | 5.0E-08 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 46 | 221 | 6.0E-08 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 56 | 239 | 6.0E-08 |
| sp|Q0VZ70|CHSAD_CHOCO | Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 | 98 | 242 | 7.0E-08 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 99 | 221 | 7.0E-08 |
| sp|Q4WMJ7|NRP10_ASPFU | Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 | 96 | 244 | 7.0E-08 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 96 | 218 | 8.0E-08 |
| sp|Q9S725|4CL2_ARATH | 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 | 58 | 281 | 8.0E-08 |
| sp|Q5R9G9|ACSF2_PONAB | Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 | 105 | 313 | 9.0E-08 |
| sp|A7MR36|AAS_CROS8 | Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 | 198 | 271 | 9.0E-08 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 97 | 218 | 1.0E-07 |
| sp|Q0TDZ6|AAS_ECOL5 | Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|P31119|AAS_ECOLI | Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 | 196 | 271 | 1.0E-07 |
| sp|B1XDP2|AAS_ECODH | Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|C4ZZY9|AAS_ECOBW | Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|B5BFH6|AAS_SALPK | Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 | 198 | 271 | 1.0E-07 |
| sp|Q5PEN7|AAS_SALPA | Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 | 198 | 271 | 1.0E-07 |
| sp|Q83JV7|AAS_SHIFL | Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|Q0T128|AAS_SHIF8 | Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|Q1R7H5|AAS_ECOUT | Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|B1IU08|AAS_ECOLC | Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|A1AF47|AAS_ECOK1 | Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|A8A3X0|AAS_ECOHS | Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|B5Z4F4|AAS_ECO5E | Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|Q8X6J8|AAS_ECO57 | Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|B7MLI2|AAS_ECO45 | Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|A7ZQU2|AAS_ECO24 | Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|Q8FEA6|AAS_ECOL6 | Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|B7UHQ4|AAS_ECO27 | Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|Q3YY21|AAS_SHISS | Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|B5RDY6|AAS_SALG2 | Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 | 198 | 271 | 1.0E-07 |
| sp|B6I6W1|AAS_ECOSE | Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|B7LF13|AAS_ECO55 | Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|B2TYQ5|AAS_SHIB3 | Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|B7NVY2|AAS_ECO7I | Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|B4TUM9|AAS_SALSV | Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 | 198 | 271 | 1.0E-07 |
| sp|B7N768|AAS_ECOLU | Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|A9N3H8|AAS_SALPB | Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 | 198 | 271 | 1.0E-07 |
| sp|B4TGR5|AAS_SALHS | Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 | 198 | 271 | 1.0E-07 |
| sp|B5QWU2|AAS_SALEP | Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 | 198 | 271 | 1.0E-07 |
| sp|Q336M7|4CLL2_ORYSJ | 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 | 56 | 275 | 1.0E-07 |
| sp|Q8Z406|AAS_SALTI | Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 | 198 | 271 | 1.0E-07 |
| sp|B5F4V4|AAS_SALA4 | Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 | 198 | 271 | 1.0E-07 |
| sp|B1LR34|AAS_ECOSM | Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|Q8ZMA4|AAS_SALTY | Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 | 198 | 271 | 1.0E-07 |
| sp|B4T503|AAS_SALNS | Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 | 198 | 271 | 1.0E-07 |
| sp|B5FUB9|AAS_SALDC | Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 | 198 | 271 | 1.0E-07 |
| sp|B7LNJ2|AAS_ESCF3 | Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 | 196 | 271 | 1.0E-07 |
| sp|E3UUE6|FAC19_RHORH | 3-oxocholest-4-en-26-oate--CoA ligase OS=Rhodococcus rhodochrous GN=fadD19 PE=1 SV=1 | 63 | 279 | 1.0E-07 |
| sp|A4WE11|AAS_ENT38 | Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 | 198 | 271 | 1.0E-07 |
| sp|Q84P21|4CLL5_ARATH | 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 | 59 | 273 | 1.0E-07 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 99 | 242 | 2.0E-07 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 99 | 242 | 2.0E-07 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 96 | 218 | 2.0E-07 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 96 | 266 | 2.0E-07 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 96 | 222 | 2.0E-07 |
| sp|Q7TYX8|FAC15_MYCBO | Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD15 PE=3 SV=2 | 71 | 249 | 2.0E-07 |
| sp|Q8LKS5|LACS7_ARATH | Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 | 193 | 310 | 2.0E-07 |
| sp|P9WQ51|FAC19_MYCTU | Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD19 PE=1 SV=1 | 99 | 281 | 2.0E-07 |
| sp|P9WQ50|FAC19_MYCTO | Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD19 PE=3 SV=1 | 99 | 281 | 2.0E-07 |
| sp|Q7TWB7|FAC19_MYCBO | Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD19 PE=3 SV=1 | 99 | 281 | 2.0E-07 |
| sp|B2HGV4|FAC15_MYCMM | Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD15 PE=3 SV=1 | 96 | 249 | 2.0E-07 |
| sp|P14913|4CL2_PETCR | 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 | 56 | 273 | 2.0E-07 |
| sp|C0PXJ8|AAS_SALPC | Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 | 199 | 271 | 3.0E-07 |
| sp|Q57KA7|AAS_SALCH | Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 | 199 | 271 | 3.0E-07 |
| sp|O53521|FAC15_MYCTU | Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD15 PE=1 SV=3 | 71 | 249 | 4.0E-07 |
| sp|Q0S7V5|FAD3_RHOJR | 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 | 96 | 266 | 4.0E-07 |
| sp|C0SPB0|YTCI_BACSU | Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 | 67 | 232 | 4.0E-07 |
| sp|Q53005|4HBCL_RHOPA | 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 | 67 | 313 | 4.0E-07 |
| sp|B2HI05|FAC19_MYCMM | Long-chain-fatty-acid--CoA/3-oxocholest-4-en-26-oate--CoA ligase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD19 PE=3 SV=1 | 96 | 282 | 5.0E-07 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 85 | 239 | 6.0E-07 |
| sp|O53580|FAA32_MYCTU | Long-chain-fatty-acid--AMP ligase FadD32 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD32 PE=1 SV=1 | 96 | 271 | 7.0E-07 |
| sp|Q8LPS1|LACS6_ARATH | Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana GN=LACS6 PE=1 SV=1 | 193 | 310 | 7.0E-07 |
| sp|Q7TTR2|FAA32_MYCBO | Long-chain-fatty-acid--AMP ligase FadD32 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD32 PE=3 SV=1 | 96 | 271 | 7.0E-07 |
| sp|P39846|PPSB_BACSU | Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 | 96 | 218 | 1.0E-06 |
| sp|Q70LM7|LGRA_BREPA | Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 | 99 | 221 | 1.0E-06 |
| sp|A7GU88|MENE_BACCN | 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 | 96 | 316 | 1.0E-06 |
| sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 46 | 221 | 1.0E-06 |
| sp|Q5SKN9|LCFCS_THET8 | Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 | 96 | 250 | 1.0E-06 |
| sp|Q9R9I9|MYCC_BACIU | Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 | 99 | 242 | 1.0E-06 |
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 99 | 266 | 1.0E-06 |
| sp|E2JA29|DDAD_ENTAG | Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 | 68 | 227 | 1.0E-06 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 99 | 218 | 2.0E-06 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 99 | 218 | 2.0E-06 |
| sp|P45745|DHBF_BACSU | Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 | 55 | 238 | 2.0E-06 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 99 | 269 | 2.0E-06 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 99 | 269 | 2.0E-06 |
| sp|P96843|FAD3_MYCTU | 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 | 99 | 266 | 2.0E-06 |
| sp|P9WQ43|FAA26_MYCTU | Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD26 PE=1 SV=1 | 46 | 273 | 2.0E-06 |
| sp|P9WQ42|FAA26_MYCTO | Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD26 PE=3 SV=1 | 46 | 273 | 2.0E-06 |
| sp|Q7TXM1|FAA26_MYCBO | Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD26 PE=1 SV=1 | 46 | 262 | 2.0E-06 |
| sp|P41636|4CL_PINTA | 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 | 56 | 273 | 2.0E-06 |
| sp|B2HIN2|FAA26_MYCMM | Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD26 PE=3 SV=1 | 96 | 273 | 2.0E-06 |
| sp|Q4WF61|NRPS3_ASPFU | Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 | 1 | 242 | 3.0E-06 |
| sp|Q4WYG2|NRPS5_ASPFU | Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 | 96 | 273 | 3.0E-06 |
| sp|B2HIM0|FAA28_MYCMM | Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 | 96 | 263 | 3.0E-06 |
| sp|Q8VZF1|AEE7_ARATH | Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 | 39 | 313 | 3.0E-06 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 46 | 221 | 4.0E-06 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 96 | 266 | 4.0E-06 |
| sp|O24145|4CL1_TOBAC | 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 | 98 | 273 | 4.0E-06 |
| sp|O68007|BACB_BACLI | Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 | 99 | 221 | 4.0E-06 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 46 | 221 | 5.0E-06 |
| sp|B2HMK0|FAA32_MYCMM | Long-chain-fatty-acid--AMP ligase FadD32 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD32 PE=3 SV=1 | 96 | 271 | 5.0E-06 |
| sp|Q9AJS8|3HBCL_THAAR | 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 | 67 | 266 | 5.0E-06 |
| sp|P39847|PPSC_BACSU | Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 | 99 | 268 | 6.0E-06 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 51 | 228 | 7.0E-06 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 46 | 221 | 8.0E-06 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 96 | 266 | 9.0E-06 |
| sp|Q838K1|MENE_ENTFA | 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 | 95 | 277 | 9.0E-06 |
| sp|P31685|4CL2_SOLTU | 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 | 98 | 273 | 9.0E-06 |
| sp|P31684|4CL1_SOLTU | 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 | 98 | 273 | 1.0E-05 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 11 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|5368 MTSPSPALPLLLRRLLCRLPRPGPGPARAVASRTVMSSSALPPLPLLRAIASHDPDAPAVLHCTSGRSFAYGRLL PDVACARDRLRHAAGRADLDGRTVAFLVENSYDYVVTLLAVLAAGAIAVPLSPAFPTSELQYILDHSQASVLVSS QRFAAKADDLLAAGLVSQPAHLRLAKHVDGPAGRPVAFEDADPAASAASLMLYTSGTTNRPKGVVLPHATLAAQA QSLIEAWRYSPSDRLLHVLPLHHIHGAVNAVLTPLVAGASVEFLFPFNADAVWRRLAAPFVADSAATSPAPVTFF TAVPTVYSRLLSSHGTLPAAHLRIGGAADAG* |
| Coding | >Hirsu2|5368 ATGACATCGCCCTCGCCAGCCCTGCCGCTGCTGCTGCGGCGCCTGCTCTGCCGCCTCCCCCGCCCGGGCCCCGGC CCCGCCCGGGCCGTGGCCTCCAGGACCGTCATGTCCTCCTCCGCCCTGCCGCCCCTGCCGCTCCTCCGCGCCATC GCCTCCCACGACCCGGACGCCCCGGCCGTCCTGCACTGCACCTCCGGCCGCTCCTTCGCCTACGGCCGCCTGCTG CCCGACGTCGCCTGCGCCCGGGACCGCCTGCGCCACGCCGCGGGCCGGGCCGACCTCGACGGCCGGACCGTCGCC TTTCTCGTCGAGAACAGCTACGACTACGTAGTGACGCTGCTGGCCGTCCTGGCGGCCGGCGCCATCGCCGTGCCC CTGTCCCCGGCCTTCCCGACCTCGGAGCTGCAGTACATCCTCGACCACAGTCAGGCCTCTGTGCTCGTCTCCTCG CAGCGTTTCGCCGCCAAGGCCGATGACCTGCTGGCCGCCGGCCTGGTCTCCCAGCCCGCCCACCTGCGCCTGGCC AAGCACGTCGACGGCCCGGCCGGCCGGCCCGTCGCCTTCGAAGACGCCGATCCGGCCGCCAGTGCCGCGAGCCTG ATGCTGTACACGTCGGGGACGACGAATCGACCGAAAGGCGTTGTTCTCCCGCACGCGACCCTGGCGGCGCAGGCG CAGTCGCTGATCGAGGCTTGGCGCTATTCGCCCTCGGACCGCCTCCTGCACGTACTCCCGCTGCACCACATCCAC GGCGCCGTCAACGCCGTGCTGACGCCCCTCGTCGCCGGCGCCTCGGTCGAGTTCCTGTTCCCCTTCAACGCCGAC GCCGTGTGGAGGCGCCTGGCCGCGCCCTTCGTCGCCGATTCGGCGGCAACGTCGCCGGCGCCCGTCACCTTCTTC ACCGCCGTCCCCACCGTCTACAGCCGGCTGCTGTCCAGCCACGGGACGCTGCCGGCGGCGCATCTCCGGATCGGC GGCGCTGCCGACGCCGGTTAA |
| Transcript | >Hirsu2|5368 ATGACATCGCCCTCGCCAGCCCTGCCGCTGCTGCTGCGGCGCCTGCTCTGCCGCCTCCCCCGCCCGGGCCCCGGC CCCGCCCGGGCCGTGGCCTCCAGGACCGTCATGTCCTCCTCCGCCCTGCCGCCCCTGCCGCTCCTCCGCGCCATC GCCTCCCACGACCCGGACGCCCCGGCCGTCCTGCACTGCACCTCCGGCCGCTCCTTCGCCTACGGCCGCCTGCTG CCCGACGTCGCCTGCGCCCGGGACCGCCTGCGCCACGCCGCGGGCCGGGCCGACCTCGACGGCCGGACCGTCGCC TTTCTCGTCGAGAACAGCTACGACTACGTAGTGACGCTGCTGGCCGTCCTGGCGGCCGGCGCCATCGCCGTGCCC CTGTCCCCGGCCTTCCCGACCTCGGAGCTGCAGTACATCCTCGACCACAGTCAGGCCTCTGTGCTCGTCTCCTCG CAGCGTTTCGCCGCCAAGGCCGATGACCTGCTGGCCGCCGGCCTGGTCTCCCAGCCCGCCCACCTGCGCCTGGCC AAGCACGTCGACGGCCCGGCCGGCCGGCCCGTCGCCTTCGAAGACGCCGATCCGGCCGCCAGTGCCGCGAGCCTG ATGCTGTACACGTCGGGGACGACGAATCGACCGAAAGGCGTTGTTCTCCCGCACGCGACCCTGGCGGCGCAGGCG CAGTCGCTGATCGAGGCTTGGCGCTATTCGCCCTCGGACCGCCTCCTGCACGTACTCCCGCTGCACCACATCCAC GGCGCCGTCAACGCCGTGCTGACGCCCCTCGTCGCCGGCGCCTCGGTCGAGTTCCTGTTCCCCTTCAACGCCGAC GCCGTGTGGAGGCGCCTGGCCGCGCCCTTCGTCGCCGATTCGGCGGCAACGTCGCCGGCGCCCGTCACCTTCTTC ACCGCCGTCCCCACCGTCTACAGCCGGCTGCTGTCCAGCCACGGGACGCTGCCGGCGGCGCATCTCCGGATCGGC GGCGCTGCCGACGCCGGTTAA |
| Gene | >Hirsu2|5368 ATGACATCGCCCTCGCCAGCCCTGCCGCTGCTGCTGCGGCGCCTGCTCTGCCGCCTCCCCCGCCCGGGCCCCGGC CCCGCCCGGGCCGTGGCCTCCAGGACCGTCATGTCCTCCTCCGCCCTGCCGCCCCTGCCGCTCCTCCGCGCCATC GCCTCCCACGACCCGGACGCCCCGGCCGTCCTGCACTGCACCTCCGGCCGCTCCTTCGCCTACGGCCGCCTGCTG CCCGACGTCGCCTGCGCCCGGGACCGCCTGCGCCACGCCGCGGGCCGGGCCGACCTCGACGGCCGGACCGTCGCC TTTCTCGTCGAGAACAGCTACGACTACGTAGGTGAGCTCTCTCTCTCTCTCTCCCCCTTCCGCTCCTTCGTGTGC AGGTCCGCCCTTCTCCGGAGAGAGTCGTCATTGGACAAAGCGGCTCTCGCAAACATCCTCGGTGCTAACACCAAC CGCTCTCCTCCCGCAGTGACGCTGCTGGCCGTCCTGGCGGCCGGCGCCATCGCCGTGCCCCTGTCCCCGGCCTTC CCGACCTCGGAGCTGCAGTACATCCTCGACCACAGTCAGGCCTCTGTGCTCGTCTCCTCGCAGCGTTTCGCCGCC AAGGCCGATGACCTGCTGGCCGCCGGCCTGGTCTCCCAGCCCGCCCACCTGCGCCTGGCCAAGCACGTCGACGGC CCGGCCGGCCGGCCCGTCGCCTTCGAAGACGCCGATCCGGCCGCCAGTGCCGCGAGCCTGATGCTGTACACGTCG GGGACGACGAATCGACCGGTAAGTAGCAGCAAAAACCCTTCGCCCGACCACCCTTCCGCCTCAAAAAGGGGAGAG GGTTCGTACAGTTTTTCGAGAGAGCTTCTTTGACCGCCGCTCGTGTAGAAAGGCGTTGTTCTCCCGCACGCGACC CTGGCGGCGCAGGCGCAGTCGCTGATCGAGGCTTGGCGCTATTCGCCCTCGGACCGCCTCCTGCACGTACTCCCG CTGCACCACATCCACGGCGCCGTCAACGCCGTGCTGACGCCCCTCGTCGCCGGCGCCTCGGTCGAGTTCCTGTTC CCCTTCAACGCCGACGCCGTGTGGAGGCGCCTGGCCGCGCCCTTCGTCGCCGATTCGGCGGCAACGTCGCCGGCG CCCGTCACCTTCTTCACCGCCGTCCCCACCGTCTACAGCCGGCTGCTGTCCAGCCACGGGACGCTGCCGGCGGCG GTGCAGGAGGCCGGCCGGCGGGCCGTGTCGCCCGACAGCATGCGGCTCAGCATCTCCGGATCGGCGGCGCTGCCG ACGCCGGTTAA |